(data stored in ACNUC7421 zone)

EMBL: CP001349.PE448

CP001349.PE448       Location/Qualifiers
FT   CDS             513469..514146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55500"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB2"
FT                   /inference="similar to AA sequence:KEGG:M446_2009"
FT                   /protein_id="ACL55500.1"
FT                   /translation="MPDGCRDEAGAQQLGFSAFPEGTSRVSTIMRAILLGLAALAVAAG
FT                   HPVQAADLAAPVPAPDYHPPVQPLSIVSELRIGGSVQDPWSPESGSGNVTGEVLLAKPT
FT                   LTPDPFWNQFIPRPTVGGSYNTAGRTSYAYLGATWTFDITERFFVEGFFGASFHNGATG
FT                   RFVPPGFNALGCSPLFREAGSVGFRITEHWSVLATIEHQSNAGLCVANRGLTNVGGKIA
FT                   YTF"
     MPDGCRDEAG AQQLGFSAFP EGTSRVSTIM RAILLGLAAL AVAAGHPVQA ADLAAPVPAP        60
     DYHPPVQPLS IVSELRIGGS VQDPWSPESG SGNVTGEVLL AKPTLTPDPF WNQFIPRPTV       120
     GGSYNTAGRT SYAYLGATWT FDITERFFVE GFFGASFHNG ATGRFVPPGF NALGCSPLFR       180
     EAGSVGFRIT EHWSVLATIE HQSNAGLCVA NRGLTNVGGK IAYTF                       225
//

If you have problems or comments...

PBIL Back to PBIL home page