(data stored in ACNUC7421 zone)

EMBL: CP001349.PE449

CP001349.PE449       Location/Qualifiers
FT   CDS             514258..514833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0459"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: met:M446_2008
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55501"
FT                   /db_xref="GOA:B8ICB3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB3"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACL55501.1"
FT                   /translation="MVVLNRIYTRTGDTGTTALASGERRSKADLRIETYGTVDETNACV
FT                   GLARQHSTGDLDAMLSRIQNDLFDLGADLATPESDTPPAYEPLRIVPEQVERVEREIDA
FT                   LNAGLQPLRSFVLPGGTAAAAALHLARTVCRRAERLAVALAATPGERVSPVAIQYLNRL
FT                   SDFLFVASRVANDGGAKDVLWVPGKNRG"
     MVVLNRIYTR TGDTGTTALA SGERRSKADL RIETYGTVDE TNACVGLARQ HSTGDLDAML        60
     SRIQNDLFDL GADLATPESD TPPAYEPLRI VPEQVERVER EIDALNAGLQ PLRSFVLPGG       120
     TAAAAALHLA RTVCRRAERL AVALAATPGE RVSPVAIQYL NRLSDFLFVA SRVANDGGAK       180
     DVLWVPGKNR G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page