(data stored in ACNUC7421 zone)

EMBL: CP001349.PE45

CP001349.PE45        Location/Qualifiers
FT   CDS             complement(50375..52192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0046"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: met:M446_0046 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55097"
FT                   /db_xref="GOA:B8IU52"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU52"
FT                   /inference="protein motif:PFAM:PF03445"
FT                   /protein_id="ACL55097.1"
FT                   /translation="MQTFDVLNPPFDRLTAAEADSLRRHVDVGYFRPGTVIVTQGKEAD
FT                   LLHVVIKGAVEARNQGALLAVLRAGDTFDARAVVHGEAGENFVAAEETLCFLIPREVIV
FT                   RLVHANSAFAAFFYAEISRKLDALASWQRRESMDSVLRTRIRDARHAPAVFLSGGSTLE
FT                   EAARRMLAADVDAVFVEDAGRTGLLTGHKVTRAAVIEHRPFDTPVRDLAKFDVTAVEAD
FT                   QFLLDALLVMTRHGNRRIAVRQDGAYVGWLRDIDLLGAFAGNAQLVPSRIDRAASIEDL
FT                   REPARDIQAQGQQLHRQGVRVDAVAQVISDLNRRLYARLFALLAPAAIREAGCLFLMGS
FT                   EGRGEQTYRTDQDNGLILSRPVPQAELADFRDAFSAALGELGYPPCPGEIMVRNPLWSQ
FT                   EADHFVNQLRLWAQAGDPDAAMNLAIFADATAVAGDPAPLQRAKTFLTEAVRGETRLLA
FT                   QIANLINIAGDAANGGLVDAVFSRVGLRRNELDLKRAGLFPLVHGVRVLAIEAGIAPTG
FT                   TVERIRALTQGGILEEGFGRDLASALLALMGLRFDRQLAAAQRGQGLGPVILDFDAMPT
FT                   LERDLLRDSLRIVRRLREVIHVRYALGQF"
     MQTFDVLNPP FDRLTAAEAD SLRRHVDVGY FRPGTVIVTQ GKEADLLHVV IKGAVEARNQ        60
     GALLAVLRAG DTFDARAVVH GEAGENFVAA EETLCFLIPR EVIVRLVHAN SAFAAFFYAE       120
     ISRKLDALAS WQRRESMDSV LRTRIRDARH APAVFLSGGS TLEEAARRML AADVDAVFVE       180
     DAGRTGLLTG HKVTRAAVIE HRPFDTPVRD LAKFDVTAVE ADQFLLDALL VMTRHGNRRI       240
     AVRQDGAYVG WLRDIDLLGA FAGNAQLVPS RIDRAASIED LREPARDIQA QGQQLHRQGV       300
     RVDAVAQVIS DLNRRLYARL FALLAPAAIR EAGCLFLMGS EGRGEQTYRT DQDNGLILSR       360
     PVPQAELADF RDAFSAALGE LGYPPCPGEI MVRNPLWSQE ADHFVNQLRL WAQAGDPDAA       420
     MNLAIFADAT AVAGDPAPLQ RAKTFLTEAV RGETRLLAQI ANLINIAGDA ANGGLVDAVF       480
     SRVGLRRNEL DLKRAGLFPL VHGVRVLAIE AGIAPTGTVE RIRALTQGGI LEEGFGRDLA       540
     SALLALMGLR FDRQLAAAQR GQGLGPVILD FDAMPTLERD LLRDSLRIVR RLREVIHVRY       600
     ALGQF                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page