(data stored in ACNUC7421 zone)

EMBL: CP001349.PE450

CP001349.PE450       Location/Qualifiers
FT   CDS             515064..515813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0460"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: met:M446_2007 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55502"
FT                   /db_xref="GOA:B8ICB4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB4"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACL55502.1"
FT                   /translation="MKVLVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVEE
FT                   AIRLKEKAKVSEIVAVSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLRAL
FT                   VDKEQPQLVILGKQAIDDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREIDGGL
FT                   QTLTLALPAIVTTDLRLNEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVLKTVE
FT                   PGGRQAGVKVASAAELVSKLKGEAGVL"
     MKVLVPVKRV VDYNVKIRVK PDGSGVDLAN VKMAMNPFDE IAVEEAIRLK EKAKVSEIVA        60
     VSIGPQQAQE TLRTALAMGA DRGILVRTDA PVEPLAVAKL LRALVDKEQP QLVILGKQAI       120
     DDDANQTGQM LAALLGWPQG TFAYRIELGE GSLEVTREID GGLQTLTLAL PAIVTTDLRL       180
     NEPRYASLPN IMKAKKKPLD TLEPAALGVD VAPRLKVLKT VEPGGRQAGV KVASAAELVS       240
     KLKGEAGVL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page