(data stored in ACNUC7421 zone)

EMBL: CP001349.PE451

CP001349.PE451       Location/Qualifiers
FT   CDS             515845..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0461"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: met:M446_2006 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55503"
FT                   /db_xref="GOA:B8ICB5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB5"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACL55503.1"
FT                   /translation="MATLLLVEHAHGAPKDGSLKALTAARQLGAPVHALVTGAGSRPAA
FT                   EATARLEGVEKVLLAENAAFDHLLAEPTAALLAELAAGYDAVIAAASTEGKNVLPRVAA
FT                   LLDVAQVSDITKVVAPDTFERPIYAGNAIQTVQVSEPKKVITVRTAAFKAAEAGGAPAP
FT                   IEAAAAAVAPEVKSAFKGEEIAQSDRPELASARIVVSGGRSLGSAEKFRELIEPLADAL
FT                   GAAVGASRAAVDAGYAPNDWQVGQTGKVVAPDLYVAVGISGAIQHLAGMKDSKVIVAIN
FT                   KDEEAPIFQVADYGLVGDLFQIVPELQQEIAKAKG"
     MATLLLVEHA HGAPKDGSLK ALTAARQLGA PVHALVTGAG SRPAAEATAR LEGVEKVLLA        60
     ENAAFDHLLA EPTAALLAEL AAGYDAVIAA ASTEGKNVLP RVAALLDVAQ VSDITKVVAP       120
     DTFERPIYAG NAIQTVQVSE PKKVITVRTA AFKAAEAGGA PAPIEAAAAA VAPEVKSAFK       180
     GEEIAQSDRP ELASARIVVS GGRSLGSAEK FRELIEPLAD ALGAAVGASR AAVDAGYAPN       240
     DWQVGQTGKV VAPDLYVAVG ISGAIQHLAG MKDSKVIVAI NKDEEAPIFQ VADYGLVGDL       300
     FQIVPELQQE IAKAKG                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page