(data stored in ACNUC7421 zone)

EMBL: CP001349.PE452

CP001349.PE452       Location/Qualifiers
FT   CDS             516965..517846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0462"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   met:M446_2005 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55504"
FT                   /db_xref="GOA:B8ICB6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACL55504.1"
FT                   /translation="MGIEIKTVGIIGAGQMGSGIAHVCAVSGLDVRLNDRDPERLKNGL
FT                   ATVNGNLQRQVAKGTITEEARRAAIERIQPVESFDEFTPCDLVIEAATEDEAIKRNIFS
FT                   ALCPSLRPETMVATNTSSISITRLAASTDRPERFIGIHFMNPVPVMQLVELIRGIATED
FT                   PTFESARTFVNRLGKTVTVSEDFPAFIVNRILLPMINEAIYTLYEGVGSVDSIDTAMRL
FT                   GANHPMGPLQLADFIGLDTCLSIMQVLYEGLADSKYRPCPLLVKYVEAGWLGRKSKRGF
FT                   YDYRGPEPVPTR"
     MGIEIKTVGI IGAGQMGSGI AHVCAVSGLD VRLNDRDPER LKNGLATVNG NLQRQVAKGT        60
     ITEEARRAAI ERIQPVESFD EFTPCDLVIE AATEDEAIKR NIFSALCPSL RPETMVATNT       120
     SSISITRLAA STDRPERFIG IHFMNPVPVM QLVELIRGIA TEDPTFESAR TFVNRLGKTV       180
     TVSEDFPAFI VNRILLPMIN EAIYTLYEGV GSVDSIDTAM RLGANHPMGP LQLADFIGLD       240
     TCLSIMQVLY EGLADSKYRP CPLLVKYVEA GWLGRKSKRG FYDYRGPEPV PTR              293
//

If you have problems or comments...

PBIL Back to PBIL home page