(data stored in ACNUC7421 zone)

EMBL: CP001349.PE453

CP001349.PE453       Location/Qualifiers
FT   CDS             complement(517911..518225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55505"
FT                   /db_xref="GOA:B8ICB7"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB7"
FT                   /inference="similar to AA sequence:KEGG:M446_2004"
FT                   /protein_id="ACL55505.1"
FT                   /translation="MAIDDRRVETTTEARQGTKGKPVLYVLLGSLALLVIAAVALLTWN
FT                   GANSPKDYASQSQDASRAQITGSAGGKGNVTNPSSHVPAGNPAYPQPSQPTTTGSTNPR
FT                   "
     MAIDDRRVET TTEARQGTKG KPVLYVLLGS LALLVIAAVA LLTWNGANSP KDYASQSQDA        60
     SRAQITGSAG GKGNVTNPSS HVPAGNPAYP QPSQPTTTGS TNPR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page