(data stored in ACNUC7421 zone)

EMBL: CP001349.PE454

CP001349.PE454       Location/Qualifiers
FT   CDS             complement(518323..519330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0464"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_2003 PIG3 family NAD(P)H quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55506"
FT                   /db_xref="GOA:B8ICB8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB8"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACL55506.1"
FT                   /translation="MPALPDTMRQVRFNGAGGPEVIGIETAPVPKPGPGQVLIEVVAAG
FT                   VNRPDCQQRAGKYPPPPGATDVPGLEVAGRIAALGEGVTGLAVGDEVCALVISGGYAEF
FT                   CLAEAPLCLPKPGPLSLIEAAGLPENYYTVWTNVFERGRLQKGERFLVHGGSSGIGYTA
FT                   IQLAKHFGATVYATAGSADKCAFCERMGADVAINYRETDFAEEVKRLTDGKGVDVILDM
FT                   VGASYLERNLKSLALEGRLVVIAFLQGFKVESFNMTPIMVKRLTFTGSTLRPRTTAQKA
FT                   AIAEGLRREVWPLLESGALKAVIHATFPLEQAREAHALMESSAHLGKIMLTTGR"
     MPALPDTMRQ VRFNGAGGPE VIGIETAPVP KPGPGQVLIE VVAAGVNRPD CQQRAGKYPP        60
     PPGATDVPGL EVAGRIAALG EGVTGLAVGD EVCALVISGG YAEFCLAEAP LCLPKPGPLS       120
     LIEAAGLPEN YYTVWTNVFE RGRLQKGERF LVHGGSSGIG YTAIQLAKHF GATVYATAGS       180
     ADKCAFCERM GADVAINYRE TDFAEEVKRL TDGKGVDVIL DMVGASYLER NLKSLALEGR       240
     LVVIAFLQGF KVESFNMTPI MVKRLTFTGS TLRPRTTAQK AAIAEGLRRE VWPLLESGAL       300
     KAVIHATFPL EQAREAHALM ESSAHLGKIM LTTGR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page