(data stored in ACNUC7421 zone)

EMBL: CP001349.PE455

CP001349.PE455       Location/Qualifiers
FT   CDS             complement(519442..520104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0465"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_2002 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55507"
FT                   /db_xref="GOA:B8ICB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB9"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ACL55507.1"
FT                   /translation="MQGASTRETTGAAPVTVVSHPLVQHKLTLMRDKARSTKGFRQLLN
FT                   EIGTLLAYEVTRDLPLEPIEVETPLVTMQGVQIAGKKLVLAPILRAGIGFLDGMLSLVP
FT                   SARVAHVGLYRDPDSLQAVEYYFKAPSDLADRTVLVLDPMLATANSAIAAVDRLKERGA
FT                   RDLRIVCLIAAPEGLAKFRGAHPDVPVWTAAIDSHLDEHGYIIPGLGDAGDRMYGTR"
     MQGASTRETT GAAPVTVVSH PLVQHKLTLM RDKARSTKGF RQLLNEIGTL LAYEVTRDLP        60
     LEPIEVETPL VTMQGVQIAG KKLVLAPILR AGIGFLDGML SLVPSARVAH VGLYRDPDSL       120
     QAVEYYFKAP SDLADRTVLV LDPMLATANS AIAAVDRLKE RGARDLRIVC LIAAPEGLAK       180
     FRGAHPDVPV WTAAIDSHLD EHGYIIPGLG DAGDRMYGTR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page