(data stored in ACNUC7421 zone)

EMBL: CP001349.PE456

CP001349.PE456       Location/Qualifiers
FT   CDS             complement(520156..521412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0466"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bra:BRADO1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55508"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC0"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ACL55508.1"
FT                   /translation="MSVPQDRNETPSVQDARWLLTPEAVRARAEGLLALGLDGGLEHFA
FT                   VHPDRLGPCADAVVETIRAAYPDLDIPYHARWRHFSVGGFDRWGSLLQAASWEDVAARA
FT                   RAAFDLVIVSVLLDAGAGPTWRYEEGRTGETYARSEGLAVASFDLFISGLFSEAPEDPF
FT                   RVDARALASLTVADLAQGFQVTPTNPLVGLEGRTALLNRLGQVVAADPDGFGPEARPGG
FT                   LYDRLAARATDGALPATAILSALLAHLGPIWPGRITLDGVDLGDTWRHSRAGGEGETAG
FT                   LVPFHKLSQWLAYSLLEPLEEAGLTVTGLDALTGLPEYRNGGLFLDTGVLTLKRPEEAS
FT                   RAHPVESELVVEWRALTVALLDRLAPLVRERLGIGDPADLPLAKVLEGGTWATGRRLAR
FT                   ALRPDGTPPLAIASDGTVF"
     MSVPQDRNET PSVQDARWLL TPEAVRARAE GLLALGLDGG LEHFAVHPDR LGPCADAVVE        60
     TIRAAYPDLD IPYHARWRHF SVGGFDRWGS LLQAASWEDV AARARAAFDL VIVSVLLDAG       120
     AGPTWRYEEG RTGETYARSE GLAVASFDLF ISGLFSEAPE DPFRVDARAL ASLTVADLAQ       180
     GFQVTPTNPL VGLEGRTALL NRLGQVVAAD PDGFGPEARP GGLYDRLAAR ATDGALPATA       240
     ILSALLAHLG PIWPGRITLD GVDLGDTWRH SRAGGEGETA GLVPFHKLSQ WLAYSLLEPL       300
     EEAGLTVTGL DALTGLPEYR NGGLFLDTGV LTLKRPEEAS RAHPVESELV VEWRALTVAL       360
     LDRLAPLVRE RLGIGDPADL PLAKVLEGGT WATGRRLARA LRPDGTPPLA IASDGTVF         418
//

If you have problems or comments...

PBIL Back to PBIL home page