(data stored in ACNUC7421 zone)

EMBL: CP001349.PE457

CP001349.PE457       Location/Qualifiers
FT   CDS             complement(521693..522949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55509"
FT                   /db_xref="GOA:B8ICC1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC1"
FT                   /inference="similar to AA sequence:KEGG:M446_2000"
FT                   /protein_id="ACL55509.1"
FT                   /translation="MTTSNRSTHIRLTSHPEPRAARWPIRWGAADPRERGPVIGTVTNP
FT                   ADRNVIGANGGAYSLYRALAIAGRALNPLARPDLTNTHPVVPIGPHPQWAEPDRIVSLD
FT                   PWGHLPGEIFAREIATGTDIRPTIAVTKARLGLPEILAAIGAHRLAPDGSILHASGDIA
FT                   VTKIAIDPVWYLPGVAARFGTTETALRRTLFEQTGGMFPELVTRPDMQVFLPPIGGCTV
FT                   YIMGDAARIAEPGTRIACRVHDECNGSDVFGSDICTCRPYLTHGIEECVREAQGGGVGV
FT                   IVYNRKEGRALGEVTKFLVYNARKRQEGGDSAATYFERTECVAGVQDARFQQLMPDVLH
FT                   WLGIRRIDRLMSMSNMKYDAITGSGIEVGERVPIPPELIPPDAAVEIEAKKAAGYYTPG
FT                   EAPDAAALDTVKGRDLDRF"
     MTTSNRSTHI RLTSHPEPRA ARWPIRWGAA DPRERGPVIG TVTNPADRNV IGANGGAYSL        60
     YRALAIAGRA LNPLARPDLT NTHPVVPIGP HPQWAEPDRI VSLDPWGHLP GEIFAREIAT       120
     GTDIRPTIAV TKARLGLPEI LAAIGAHRLA PDGSILHASG DIAVTKIAID PVWYLPGVAA       180
     RFGTTETALR RTLFEQTGGM FPELVTRPDM QVFLPPIGGC TVYIMGDAAR IAEPGTRIAC       240
     RVHDECNGSD VFGSDICTCR PYLTHGIEEC VREAQGGGVG VIVYNRKEGR ALGEVTKFLV       300
     YNARKRQEGG DSAATYFERT ECVAGVQDAR FQQLMPDVLH WLGIRRIDRL MSMSNMKYDA       360
     ITGSGIEVGE RVPIPPELIP PDAAVEIEAK KAAGYYTPGE APDAAALDTV KGRDLDRF         418
//

If you have problems or comments...

PBIL Back to PBIL home page