(data stored in ACNUC7421 zone)

EMBL: CP001349.PE458

CP001349.PE458       Location/Qualifiers
FT   CDS             complement(523080..523499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55510"
FT                   /db_xref="GOA:B8ICC2"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC2"
FT                   /inference="similar to AA sequence:KEGG:M446_1999"
FT                   /protein_id="ACL55510.1"
FT                   /translation="MTFSSAPWSNGRACRGAGPFPRRSLEIGAIVLGFIYVWPLAVAYV
FT                   VWKLMGYPAFDELKSFAERAFRGGFGGAGAFRPGTGNWAFEEYRQRELERLEEERRRLE
FT                   EESRAFAEFVEELKRARDREQFDAFMAKRRAGSNY"
     MTFSSAPWSN GRACRGAGPF PRRSLEIGAI VLGFIYVWPL AVAYVVWKLM GYPAFDELKS        60
     FAERAFRGGF GGAGAFRPGT GNWAFEEYRQ RELERLEEER RRLEEESRAF AEFVEELKRA       120
     RDREQFDAFM AKRRAGSNY                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page