(data stored in ACNUC7421 zone)

EMBL: CP001349.PE46

CP001349.PE46        Location/Qualifiers
FT   CDS             complement(52331..52789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0047"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_0047 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55098"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU53"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55098.1"
FT                   /translation="MTRLYLEDLAPGQIYRSGELTVSAEAIKRFAAEYDPQPFHLDEAR
FT                   AEASFFGGLAASGWHTAALTMRLLVESGLPLAGGVIGAGMDELRWPRPLRPGETIRLES
FT                   EVLEVRPSRSRPMQGLAKVRTTTLNQQGEPVQVLVANLVVLRREPGEG"
     MTRLYLEDLA PGQIYRSGEL TVSAEAIKRF AAEYDPQPFH LDEARAEASF FGGLAASGWH        60
     TAALTMRLLV ESGLPLAGGV IGAGMDELRW PRPLRPGETI RLESEVLEVR PSRSRPMQGL       120
     AKVRTTTLNQ QGEPVQVLVA NLVVLRREPG EG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page