(data stored in ACNUC7421 zone)

EMBL: CP001349.PE460

CP001349.PE460       Location/Qualifiers
FT   CDS             complement(523967..525382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0470"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1718 protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55512"
FT                   /db_xref="GOA:B8ICC4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC4"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACL55512.1"
FT                   /translation="MRLPTRLALVAALALGPAAAVADPAPPTRALPESRGQVQLSFAPL
FT                   VRRAAPSVVNVYGAHVERRSANRNAMDEFLRRFFGETGPGGTQERAQRSLGSGVIVDAA
FT                   GLIVTNNHVIENMNEVKVALSDRREFPAEIVLRDPRTDLAVLRIKAPGGLSAMEFGDSE
FT                   GLQVGDFVLAIGNPFGVGQTVTQGIVSALARTQVGSADYQFFIQTDAAINPGNSGGALV
FT                   DLNGQLVGINTAIFSQSGGSHGIGFAIPASMVKAVVETAKGGGRLVRRPWLGARLQNVT
FT                   PDIADSVGLDHPTGVLVASMVAKSPAEEAGLKRGDVILSVDDRPVDDPEAFGYRFALKG
FT                   ISGETKLAVLRGSNRITVPVRLAPAPETRPRDTLKIRTRSPFLGATAINLSPAVAEELQ
FT                   LDLPADGVVIADVDGGSIAHRVGLQKGDVIVAVNGVPVTTTRDLDRITRGALSAWEVTI
FT                   NRGGQQLTSVFSG"
     MRLPTRLALV AALALGPAAA VADPAPPTRA LPESRGQVQL SFAPLVRRAA PSVVNVYGAH        60
     VERRSANRNA MDEFLRRFFG ETGPGGTQER AQRSLGSGVI VDAAGLIVTN NHVIENMNEV       120
     KVALSDRREF PAEIVLRDPR TDLAVLRIKA PGGLSAMEFG DSEGLQVGDF VLAIGNPFGV       180
     GQTVTQGIVS ALARTQVGSA DYQFFIQTDA AINPGNSGGA LVDLNGQLVG INTAIFSQSG       240
     GSHGIGFAIP ASMVKAVVET AKGGGRLVRR PWLGARLQNV TPDIADSVGL DHPTGVLVAS       300
     MVAKSPAEEA GLKRGDVILS VDDRPVDDPE AFGYRFALKG ISGETKLAVL RGSNRITVPV       360
     RLAPAPETRP RDTLKIRTRS PFLGATAINL SPAVAEELQL DLPADGVVIA DVDGGSIAHR       420
     VGLQKGDVIV AVNGVPVTTT RDLDRITRGA LSAWEVTINR GGQQLTSVFS G                471
//

If you have problems or comments...

PBIL Back to PBIL home page