(data stored in ACNUC7421 zone)

EMBL: CP001349.PE461

CP001349.PE461       Location/Qualifiers
FT   CDS             complement(525456..526724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0471"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1719 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55513"
FT                   /db_xref="GOA:B8ICC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55513.1"
FT                   /translation="MHVAILTNFCLPRGGGEKVAIESARGLAEAGVAVSFLHGVDGPAD
FT                   PMLDHPGIRRIGLGLTDVWDEPAWRGARDGIWNRLAARRLRAALAELRPDCLHLHNWTR
FT                   SLSPAVLPVLAGCRLPVAVTLHDYFLVCPNGVYYRFDRAEPCSLAPLGARCLASPCDPQ
FT                   SRAHKLVRVARAAATRIGLMRGFGDRAIDLVHVSDASRARLEPMLPGSGFRHHRIDNPV
FT                   RVERRAPADPARGDAVVFVGRFTREKGADLVAEAARMAGLPALFIGDGPLAEKLAAMPG
FT                   VEVLGWREPAAVEALLRARARAVVAPSRWLETGPLTVYEALACGIPAIASNRAGAAARI
FT                   VPGETGFVTAPEAHLLARIFHDLADDALARRMGLAAHARYWAAPLTLAAHAEGAARLYA
FT                   TMIGRPAPLGATATAPSFQRSPV"
     MHVAILTNFC LPRGGGEKVA IESARGLAEA GVAVSFLHGV DGPADPMLDH PGIRRIGLGL        60
     TDVWDEPAWR GARDGIWNRL AARRLRAALA ELRPDCLHLH NWTRSLSPAV LPVLAGCRLP       120
     VAVTLHDYFL VCPNGVYYRF DRAEPCSLAP LGARCLASPC DPQSRAHKLV RVARAAATRI       180
     GLMRGFGDRA IDLVHVSDAS RARLEPMLPG SGFRHHRIDN PVRVERRAPA DPARGDAVVF       240
     VGRFTREKGA DLVAEAARMA GLPALFIGDG PLAEKLAAMP GVEVLGWREP AAVEALLRAR       300
     ARAVVAPSRW LETGPLTVYE ALACGIPAIA SNRAGAAARI VPGETGFVTA PEAHLLARIF       360
     HDLADDALAR RMGLAAHARY WAAPLTLAAH AEGAARLYAT MIGRPAPLGA TATAPSFQRS       420
     PV                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page