(data stored in ACNUC7421 zone)

EMBL: CP001349.PE462

CP001349.PE462       Location/Qualifiers
FT   CDS             526824..528098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0472"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1720 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55514"
FT                   /db_xref="GOA:B8ICC6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55514.1"
FT                   /translation="MDVVLILDHGHVNGGQAKVAIESALGLAARGHRVDLLAAVGPVDP
FT                   RLAAAGIGVTCLGQPDITTATSKLAFAGQMLWNGPAERALAGLLAGRDPRHTLVHMHAW
FT                   AKALSPSIFAAIRRAGLPALYTMHEFFLVCPNGGLYDYRRHEICHRRPLSGACMAANCD
FT                   MRSYPRKAMRLARHLLLERVARWPEGIRDVVTISALQEEVAGPLLPPGVRRHRIDNPIA
FT                   VEDAGPKPAGASGPITYVGRLSTEKGVVLLAEAARLAGIAPVFVGDGPEAETLRRLYPE
FT                   ARLLGWRDAAGVRDALRAASALVFPSIWYEGQPLTVYEALALGTPVVVSDACAGREAVA
FT                   DGETGYWFPSGDAAALAERLTRLRDPATVTALGAEAYRRYWAKPLTLSAHCDRLEEVYG
FT                   LVLRQGSAEPAAARAGDRPRLAPVG"
     MDVVLILDHG HVNGGQAKVA IESALGLAAR GHRVDLLAAV GPVDPRLAAA GIGVTCLGQP        60
     DITTATSKLA FAGQMLWNGP AERALAGLLA GRDPRHTLVH MHAWAKALSP SIFAAIRRAG       120
     LPALYTMHEF FLVCPNGGLY DYRRHEICHR RPLSGACMAA NCDMRSYPRK AMRLARHLLL       180
     ERVARWPEGI RDVVTISALQ EEVAGPLLPP GVRRHRIDNP IAVEDAGPKP AGASGPITYV       240
     GRLSTEKGVV LLAEAARLAG IAPVFVGDGP EAETLRRLYP EARLLGWRDA AGVRDALRAA       300
     SALVFPSIWY EGQPLTVYEA LALGTPVVVS DACAGREAVA DGETGYWFPS GDAAALAERL       360
     TRLRDPATVT ALGAEAYRRY WAKPLTLSAH CDRLEEVYGL VLRQGSAEPA AARAGDRPRL       420
     APVG                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page