(data stored in ACNUC7421 zone)

EMBL: CP001349.PE464

CP001349.PE464       Location/Qualifiers
FT   CDS             529834..530706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0474"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1717 PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55516"
FT                   /db_xref="GOA:B8ICC8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC8"
FT                   /inference="protein motif:PFAM:PF00595"
FT                   /protein_id="ACL55516.1"
FT                   /translation="MPDPASPLLAFSQDLAGLVARTAPSIVAVHSHRHRASGFAWKSGL
FT                   IVTADEALAEEGAITVHTADGATVAATLAGRDPSTDIALLRIGRSDLPPAPLDPGPVAA
FT                   GSLAVAVGAEEGAPTVALGLVSRAGPAWRSLRGGEIDARIELDLALRRSGEGGLALDPA
FT                   GRAIGMVVFGPRRRALVIPAATIGRVAPHLESSGRIPLGYLGLGLQAVRREDGSTGLMV
FT                   MSVEPGGPGAQAGLRQGDMITAWNGQPIRGLGMLQAALGPGSPGSTVTLAISRGGAPLE
FT                   VALTIGERP"
     MPDPASPLLA FSQDLAGLVA RTAPSIVAVH SHRHRASGFA WKSGLIVTAD EALAEEGAIT        60
     VHTADGATVA ATLAGRDPST DIALLRIGRS DLPPAPLDPG PVAAGSLAVA VGAEEGAPTV       120
     ALGLVSRAGP AWRSLRGGEI DARIELDLAL RRSGEGGLAL DPAGRAIGMV VFGPRRRALV       180
     IPAATIGRVA PHLESSGRIP LGYLGLGLQA VRREDGSTGL MVMSVEPGGP GAQAGLRQGD       240
     MITAWNGQPI RGLGMLQAAL GPGSPGSTVT LAISRGGAPL EVALTIGERP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page