(data stored in ACNUC7421 zone)

EMBL: CP001349.PE466

CP001349.PE466       Location/Qualifiers
FT   CDS             531185..532135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0476"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bra:BRADO2400 serine
FT                   protease DO-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55518"
FT                   /db_xref="GOA:B8ICD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55518.1"
FT                   /translation="MLHDASIPDDDLRDAPLDAYSRTVAGIVEAVGPAVVRVESPGRGL
FT                   GSGVVIAGDGLVLTNSHVVAGGRRVRLALADGAGAEATVIGDDPDTDLALLRADLPAGT
FT                   AAARLGESKRLRRGHLVVAIGNPLGFESTVTAGVVSALGRTLRARSGRLIDDVIQTDAA
FT                   LNPGNSGGPLVAASGEVVGIATAMIGGAQGLCFAVSSNTARFVVGEFVAHGRVRRAHLG
FT                   IVAQTLPLPRRIAVAVGAGPQAVRIGEVVPEGPAARGGLKAGDVILALDGAPVAGADDL
FT                   VRLLGAGRIGRPVAVTVLRDGAVRDHAVVPSERGP"
     MLHDASIPDD DLRDAPLDAY SRTVAGIVEA VGPAVVRVES PGRGLGSGVV IAGDGLVLTN        60
     SHVVAGGRRV RLALADGAGA EATVIGDDPD TDLALLRADL PAGTAAARLG ESKRLRRGHL       120
     VVAIGNPLGF ESTVTAGVVS ALGRTLRARS GRLIDDVIQT DAALNPGNSG GPLVAASGEV       180
     VGIATAMIGG AQGLCFAVSS NTARFVVGEF VAHGRVRRAH LGIVAQTLPL PRRIAVAVGA       240
     GPQAVRIGEV VPEGPAARGG LKAGDVILAL DGAPVAGADD LVRLLGAGRI GRPVAVTVLR       300
     DGAVRDHAVV PSERGP                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page