(data stored in ACNUC7421 zone)

EMBL: CP001349.PE467

CP001349.PE467       Location/Qualifiers
FT   CDS             532201..533127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0477"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_1715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55519"
FT                   /db_xref="GOA:B8ICD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55519.1"
FT                   /translation="MSPIIAVANLSKVYASGFQALKSVSLEIRRGEIFALLGPNGAGKT
FT                   TLIGIICGIVSPTEGRVTVDGHDIRAEYRKARRLIGLVPQELTTDAFETVWATVSFSRG
FT                   LFGLRPDPAHIERVLKDLSLWEKRDSRIMTLSGGMKRRVLIAKALSHEPQVLFLDEPTA
FT                   GVDVALRQDMWRLVRRLRDQGVTVILTTHYIEEAEEMADRVGVIRRGEIILVEDKTELM
FT                   RKLGTKQLTLQLQTRLVAVPDTLSAHRLDLSEDGTELTYTYDSQGERTGITALLTDLRA
FT                   AGIRFRDLHTRQSSLEDIFVGLVKDPA"
     MSPIIAVANL SKVYASGFQA LKSVSLEIRR GEIFALLGPN GAGKTTLIGI ICGIVSPTEG        60
     RVTVDGHDIR AEYRKARRLI GLVPQELTTD AFETVWATVS FSRGLFGLRP DPAHIERVLK       120
     DLSLWEKRDS RIMTLSGGMK RRVLIAKALS HEPQVLFLDE PTAGVDVALR QDMWRLVRRL       180
     RDQGVTVILT THYIEEAEEM ADRVGVIRRG EIILVEDKTE LMRKLGTKQL TLQLQTRLVA       240
     VPDTLSAHRL DLSEDGTELT YTYDSQGERT GITALLTDLR AAGIRFRDLH TRQSSLEDIF       300
     VGLVKDPA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page