(data stored in ACNUC7421 zone)

EMBL: CP001349.PE468

CP001349.PE468       Location/Qualifiers
FT   CDS             533124..533885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0478"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: met:M446_1714
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55520"
FT                   /db_xref="GOA:B8ICD2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACL55520.1"
FT                   /translation="MNWPAIRAIYRFEMARTWRTLLQSIVAPVISTSLYFVVFGAAIGS
FT                   RLTVIEGVPYGAFIVPGLIMLSLLTQSIANASFGIYFPRFSGTIYEILSAPISPIEIVA
FT                   GYVGAAASKSILLGLIILATASLFVQIRIEHPVWMVLFLVLTAVTFSLFGFVIGLWADG
FT                   FEKLQLVPLLIVTPLTFLGGSFYSIDMLPPFWRGLSLVNPVVYLISGFRWSFYGHGDVS
FT                   VGVSLVMALAFLAICLALVTWMFRTGYRLKT"
     MNWPAIRAIY RFEMARTWRT LLQSIVAPVI STSLYFVVFG AAIGSRLTVI EGVPYGAFIV        60
     PGLIMLSLLT QSIANASFGI YFPRFSGTIY EILSAPISPI EIVAGYVGAA ASKSILLGLI       120
     ILATASLFVQ IRIEHPVWMV LFLVLTAVTF SLFGFVIGLW ADGFEKLQLV PLLIVTPLTF       180
     LGGSFYSIDM LPPFWRGLSL VNPVVYLISG FRWSFYGHGD VSVGVSLVMA LAFLAICLAL       240
     VTWMFRTGYR LKT                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page