(data stored in ACNUC7421 zone)

EMBL: CP001349.PE469

CP001349.PE469       Location/Qualifiers
FT   CDS             534002..534799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0479"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: met:M446_1711 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55521"
FT                   /db_xref="GOA:B8ICD3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL55521.1"
FT                   /translation="MADIPTPMMRKAPNRIPSTPRPGRAPSAATVICQELRTEIASLAR
FT                   LPGQPINEKEIAARYGVSRTPVHEAMLKLADEGLVEIFPQAGTYVARIPYRDLPEVIVI
FT                   RRALEESSARLAAEHAKPADLAALDRIMVALDEAAADQDREAFRQRDEDFHAAVAGAAG
FT                   YPGLWRLTRQVKIQVDRFRRLTLPQPGRFARILIEHRAVLDAIRARDPAAACAAMGAHL
FT                   DGLLAELGGIAWLNAEYFDMSGIDPPVLTETDKRDEGVSGLGL"
     MADIPTPMMR KAPNRIPSTP RPGRAPSAAT VICQELRTEI ASLARLPGQP INEKEIAARY        60
     GVSRTPVHEA MLKLADEGLV EIFPQAGTYV ARIPYRDLPE VIVIRRALEE SSARLAAEHA       120
     KPADLAALDR IMVALDEAAA DQDREAFRQR DEDFHAAVAG AAGYPGLWRL TRQVKIQVDR       180
     FRRLTLPQPG RFARILIEHR AVLDAIRARD PAAACAAMGA HLDGLLAELG GIAWLNAEYF       240
     DMSGIDPPVL TETDKRDEGV SGLGL                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page