(data stored in ACNUC7421 zone)

EMBL: CP001349.PE47

CP001349.PE47        Location/Qualifiers
FT   CDS             complement(52794..54176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0048"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: met:M446_0048
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55099"
FT                   /db_xref="GOA:B8IU54"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU54"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACL55099.1"
FT                   /translation="MDDRTRRLLRGPIGPTLLRLAVPNVLVMLVQAGVGLIETAFVAGL
FT                   GTDALAGMALVFPLVMTVQMISAGAVGGGVLSAVARALGAGRREAAEAVAWHAVAIGLA
FT                   LGLLTTALALAFGPALYRTMGAEGATLAAACAYGGVVFAGAVLIWLFNALAAVIRGTGN
FT                   MALPAAVTCTGAAVLVPLSPALIFGVGPLPGLGIAGGGVAVLAYYAVGTAVLARYLRAG
FT                   RGVLRLGRPPALAWAPAREILRVGAASSLVSLTTNVTIATATGLVARFGSSAVAGYGTG
FT                   ARLEYLLVPLVFGLGAPISAMVGTSIGAGDRARALRVAWTGAALAVGLTETIGLAAALW
FT                   PDLFLRVFATDPAMLGTGARYLREVGPFYGFVGLGLSLYFAAQGAGRIGWPLAAGLTRL
FT                   TLAVGGGWFALRTGAGLDGIFLAQALGLVALGSINAGSVAAGVWFRARPLPAASLAARS
FT                   GA"
     MDDRTRRLLR GPIGPTLLRL AVPNVLVMLV QAGVGLIETA FVAGLGTDAL AGMALVFPLV        60
     MTVQMISAGA VGGGVLSAVA RALGAGRREA AEAVAWHAVA IGLALGLLTT ALALAFGPAL       120
     YRTMGAEGAT LAAACAYGGV VFAGAVLIWL FNALAAVIRG TGNMALPAAV TCTGAAVLVP       180
     LSPALIFGVG PLPGLGIAGG GVAVLAYYAV GTAVLARYLR AGRGVLRLGR PPALAWAPAR       240
     EILRVGAASS LVSLTTNVTI ATATGLVARF GSSAVAGYGT GARLEYLLVP LVFGLGAPIS       300
     AMVGTSIGAG DRARALRVAW TGAALAVGLT ETIGLAAALW PDLFLRVFAT DPAMLGTGAR       360
     YLREVGPFYG FVGLGLSLYF AAQGAGRIGW PLAAGLTRLT LAVGGGWFAL RTGAGLDGIF       420
     LAQALGLVAL GSINAGSVAA GVWFRARPLP AASLAARSGA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page