(data stored in ACNUC7421 zone)

EMBL: CP001349.PE470

CP001349.PE470       Location/Qualifiers
FT   CDS             535856..536548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55522"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2269"
FT                   /protein_id="ACL55522.1"
FT                   /translation="MLKEFGHAIWTANGSDVVAMLGFHYPTRMVVISLSGENLFVWSPV
FT                   ALTEDLRADVDALGKVRYLVAPNSLHHLFIADWKHAYPDARIYAAPGLQEKRKDIAFDD
FT                   ELDGASVPEWSGEIEYVVVRGNAITSEAVFFHRKSGTVIFTDLIQQFPAGWFSGWRSIV
FT                   AKWDLMLGPEPSVPRKFRAAFTNRHAARGSLERILAWPSEKVLMAHGTPVIEDSQAFLR
FT                   RAFRWLVA"
     MLKEFGHAIW TANGSDVVAM LGFHYPTRMV VISLSGENLF VWSPVALTED LRADVDALGK        60
     VRYLVAPNSL HHLFIADWKH AYPDARIYAA PGLQEKRKDI AFDDELDGAS VPEWSGEIEY       120
     VVVRGNAITS EAVFFHRKSG TVIFTDLIQQ FPAGWFSGWR SIVAKWDLML GPEPSVPRKF       180
     RAAFTNRHAA RGSLERILAW PSEKVLMAHG TPVIEDSQAF LRRAFRWLVA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page