(data stored in ACNUC7421 zone)

EMBL: CP001349.PE471

CP001349.PE471       Location/Qualifiers
FT   CDS             536733..537719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0481"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_1704 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55523"
FT                   /db_xref="GOA:B8ICD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55523.1"
FT                   /translation="MTDLRHAVVVITGASSGIGRAATLAFARRGARVALAARRREALED
FT                   LARECRAQGGKAIPVPTDVTDPDAVEHLARTAHEAFGGLDVWINNAGTGVFGPFQDAPL
FT                   DLHRRTIEVNLLGGVYGAYAALPYFLRQGHGTLITTISLGGWAPTPFAAAYTASKFGLR
FT                   GFTASLRQELRRHRHIHVCSVFPTIVDTPGLEHGANVSGRAIDTGPLVYAPEDVAETFV
FT                   YLVRHPHDEVAVGWPARLAQAAYALAPWPTEHLMGIAIHRALDRARPAPITHGAIRAPV
FT                   PERPRTSGGWRARKGLPSARTLSTVGAVMGAAGLMLLASTRAAARAR"
     MTDLRHAVVV ITGASSGIGR AATLAFARRG ARVALAARRR EALEDLAREC RAQGGKAIPV        60
     PTDVTDPDAV EHLARTAHEA FGGLDVWINN AGTGVFGPFQ DAPLDLHRRT IEVNLLGGVY       120
     GAYAALPYFL RQGHGTLITT ISLGGWAPTP FAAAYTASKF GLRGFTASLR QELRRHRHIH       180
     VCSVFPTIVD TPGLEHGANV SGRAIDTGPL VYAPEDVAET FVYLVRHPHD EVAVGWPARL       240
     AQAAYALAPW PTEHLMGIAI HRALDRARPA PITHGAIRAP VPERPRTSGG WRARKGLPSA       300
     RTLSTVGAVM GAAGLMLLAS TRAAARAR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page