(data stored in ACNUC7421 zone)

EMBL: CP001349.PE472

CP001349.PE472       Location/Qualifiers
FT   CDS             complement(537737..538459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0482"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: met:M446_1703
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55524"
FT                   /db_xref="GOA:B8ICD6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACL55524.1"
FT                   /translation="MADRTGSLKVAAIGDLHVKEEGQTSYRDLFGEISREADVLVLAGD
FT                   LTDLGTAREAEILAEELRACAIPVVGVLGNHDYESGTPEEVCRILRQTGMRLLEGQSVE
FT                   IEGVGFVGVKGFVGGFGRFTLGAFGEAAIKALVAESQHEAMRLENAMRHVASRRALVVL
FT                   HYAPVAATVQGEPPEIFPFLGSSRLAETIDRFEVGAVVHGHAHRGTFEGRTPGGVPVYN
FT                   VAIQIPKPNGRPYALLEL"
     MADRTGSLKV AAIGDLHVKE EGQTSYRDLF GEISREADVL VLAGDLTDLG TAREAEILAE        60
     ELRACAIPVV GVLGNHDYES GTPEEVCRIL RQTGMRLLEG QSVEIEGVGF VGVKGFVGGF       120
     GRFTLGAFGE AAIKALVAES QHEAMRLENA MRHVASRRAL VVLHYAPVAA TVQGEPPEIF       180
     PFLGSSRLAE TIDRFEVGAV VHGHAHRGTF EGRTPGGVPV YNVAIQIPKP NGRPYALLEL       240
//

If you have problems or comments...

PBIL Back to PBIL home page