(data stored in ACNUC7421 zone)

EMBL: CP001349.PE473

CP001349.PE473       Location/Qualifiers
FT   CDS             complement(538452..539270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD7"
FT                   /inference="similar to AA sequence:KEGG:M446_1702"
FT                   /protein_id="ACL55525.1"
FT                   /translation="MPDPRSPLPQVIAKAEPTLVSPEAEAFYAEAISRLVASGLPFLLA
FT                   GTYAVSAYTGITRETKDLDVFCKAGDAPRILAHFQDLGYTVAIEDERWLGKVFGDGHFF
FT                   DVIYASPSGATPVTEAWFAHAHQIELFGHTVRIIGPTELVWSKAFIQMRNRFDGADVAH
FT                   TILRAHEAIDWTRLLAYMEQHWELLLMHLLAFRWIYPTDREVVPAWLLDELLDRLAQLR
FT                   KLPPPQMKICRGRMLSRVDYAIDVKEWGYADLGGEGAWRDDITENAQDHG"
     MPDPRSPLPQ VIAKAEPTLV SPEAEAFYAE AISRLVASGL PFLLAGTYAV SAYTGITRET        60
     KDLDVFCKAG DAPRILAHFQ DLGYTVAIED ERWLGKVFGD GHFFDVIYAS PSGATPVTEA       120
     WFAHAHQIEL FGHTVRIIGP TELVWSKAFI QMRNRFDGAD VAHTILRAHE AIDWTRLLAY       180
     MEQHWELLLM HLLAFRWIYP TDREVVPAWL LDELLDRLAQ LRKLPPPQMK ICRGRMLSRV       240
     DYAIDVKEWG YADLGGEGAW RDDITENAQD HG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page