(data stored in ACNUC7421 zone)

EMBL: CP001349.PE474

CP001349.PE474       Location/Qualifiers
FT   CDS             complement(539597..547603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0484"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: Hemolysin-type calcium-binding region;
FT                   glycerophosphoryl diester phosphodiesterase;
FT                   metallophosphoesterase; KEGG: atc:AGR_L_909 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55526"
FT                   /db_xref="GOA:B8ICD8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD8"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACL55526.1"
FT                   /translation="MSTTTPANAVEASTDWMLGIVKAAPNQTLRVAPGGTGTASAYTLV
FT                   YDVYVPAANAGGWLPFLQTDSANSNDGDLFGKIEAGSYGIGIGGDYKGSAKLDAWNRIA
FT                   FTVETQNGEVAIGKYINGELVGSQTSTSTDRYAIDRSKGFLIFSDEDGETSAGYLGSFL
FT                   FADRALSTDEVKALGGASKEGVSKAAIAGASQFDFTDGTLNATFGTATLQATGLTPTFG
FT                   TPATLGIPAMPDASEVLTPGRANDFLVIAHRGAQAYRPEHTLEAYKLAIDMGADFIEPD
FT                   LVSTKDGVLVARHDPWLASVKLDAAGTIARDANGKPIVTSQTTNVADIAKFADKLTVKD
FT                   YAGGKVAGWFVSDFTLAEIKELRAREDQPQLRPGSASYDNQFQIPTLAEIIALVKQTEA
FT                   DTGLTIGIYPETKDPTFHKIQGLDTSKMLIDALKEAGFIDPSRVFIQSFEFANLIELKT
FT                   KIMPAAGVNLPLVQLVYFQAPYVPDDVAYNFSGAPGADPSVYNVLGLNLSATSTYEAFT
FT                   TPQALKTIANLYASGLGPDMPFVIDAATGAPKQLLLDVHAAGLKVHPYTHRDDAFGANS
FT                   KSFIDALTKAGVDGVFTDNTDTVVNAVLAAQPVQDAAGTFTGVPSLGGDPGVLHVPAPA
FT                   KKTDGFVFDPAIDGTATTYTMIFDVLVKTGDFAGDWNALFQTNLTNGDDAKFFMKKDGA
FT                   TFGIGKGDYHGSATLDTWHRIAVTLTANGDGTSTMRKYIDGVEVGSSAYATADYTIDDK
FT                   GVLLFADNDGEGVPSHLNSFYFTDRAMTGDEIKALGGSKVGGVLAAAPAQGRATQFDFA
FT                   NGTLAASFGSGTMAAAATVVPPEPAADKQAVVFGTPESLGLPALPGGQDGVISAPSFDP
FT                   DHGLELKPGFAPKNGSATFDTYTIVYDLYLPKQTGLGSIFQSDLSSRSDGDLWLGFRDD
FT                   QAVLGTDSQDEGRITLDAWHRLAFSIERISSDSFTLKKYVDGVKIGQQTVKNDFVIGDK
FT                   GFLLFADDSNETPKFSLSSVAFMEKTLSESEVAALGGASAGGPFTAPIAGVNGVQFDFS
FT                   KGEFSPSFGSGTLTARAPGVVEPPPPASVRVGAPIKDMLVTPTAANTVIDLAGVFAGNN
FT                   LTYKVETAEGRVVNASVADGKLTLDFGGLGHSDVRVTATDAAGNTAADAFRVRVAGPNA
FT                   YTIAVLPDTQDYTDQNTANGPPETFYRMTEWLAAHKDARKIQFVAHVGDVTQNNLPTEW
FT                   VVAEKAMRTLDGKIPYSLLPGNHDQANGGTAANHSSVNLDTLFSPEKQAATNPNTFRGV
FT                   YDQEPTSSRNNYHTFTAPDGTKWLILSMEFGPRDDVIRWASEVLDKHLDHRVMIISHSL
FT                   TDFASRHDAAGLGLYDEGTGADYGLRNDPQSVNDGETVYRLLSAKYPNISFTFSGHIFG
FT                   DGAETNVSYSQHGNPVYEMLVNYQNGISREITGNGNEALGNRGGNGAIRLVTIDPDNRT
FT                   LSTETYFTEFDDYLDGYRVKPELDRNGLTGSYRGHQEEFGNVELGAPELRAVAKAGDDL
FT                   YLSAPAGADRLAVTLNASRTLDPAHDIASYVWRNADGDVIARGAKPTVDLAVGRHPLTL
FT                   EVTDAKGHVTTDQKLVVVKGDATLLVENFNDGNAYGWVKPPVPVKTLSTGTPAEFGLPA
FT                   LPGGEKKVAFVPALPSNEGLRVTPNLGAPAGTRIASYSVIFDILVPPGQGDWTSLMQTD
FT                   VANKSDGDLFIRSNGNGTGGIGISSNYTGSLQYGAWQRVAFTFKEEADGTVTLNKFIEG
FT                   VKVGSQSVSGDRFKLDVSQGALFFSDEDGEVSKLYVSSLLITDKVYTEAEIAALGGAKA
FT                   GGIVASAPTPLSVQFDFNDAGLRPSFGPAEMSFGSLDNTGSSGNFVVKGSVFARPTAAE
FT                   GQAAPEARLYDQSDAKGNLLLWGDATAKSWSDYAFEATLQSTDNDAIGLVFSYQDAQNH
FT                   YRLTFNGKTNRRELVKVKDGVETVLASAAKGQPFQTDMAVKVAVLDGKISAFLNGSSIF
FT                   DGVVKDATDPLKGGTVGLYSSEQRSSMFDDLVVTKVKALAHAGADQRAIDFDGDGLASV
FT                   RLDAGASLGLADIVSYRWTDANGDEVATGIEPEVKLGLGSNALTLTVTDANGATATDRV
FT                   DIDVMAKSQVLLNESFGSAEALAKWRILDEGESGGVGPDGKSSQWELRDGRLVQLSDLQ
FT                   SRQLEWQGGATAPNLWTRGWSPLGDGVNVLRRGTQAIYDDPAAKEWTDYSVEATIKTLD
FT                   NDALGFLIHYVDAKNYYKVELDAEGNYDRKAGNGAGSLFQITRVRDGVEEVLYQVPAKY
FT                   EPGTEMRLRVDVIGGKISAFLDGEAIFAYPIEDHAHPKGTVALYSWGSEGVSFDDVRVI
FT                   APGEAAPGNLQLSGGEGDDSLTGSAGNDTIRGGAGNDTLKGFAGADQLFGQNGNDTVWG
FT                   GAGNDFVSGGFGADSVSGDAGDDLVFSDDDDDVADGGAGNDRVYGGTGADLVFGAAGDD
FT                   QVYGEWGNDFVSGGEGHDFVSGGFGNDEVNGDAGNDLLFGDDGDDAVSGGEGDDRVYGG
FT                   TGNDLVSGEAGADQVFGEQGEDVLLGGAGSDYLSGGAGADQLFGGEGADLLFGNAGADA
FT                   LTGGLGSDAFAFGRGDGQDVIRDFVTGGAERDVIAFNNGAFGSFAAVQAALRQEGSDAV
FT                   IAYGTGDTITLQNVQATSLTAQNFTFA"
     MSTTTPANAV EASTDWMLGI VKAAPNQTLR VAPGGTGTAS AYTLVYDVYV PAANAGGWLP        60
     FLQTDSANSN DGDLFGKIEA GSYGIGIGGD YKGSAKLDAW NRIAFTVETQ NGEVAIGKYI       120
     NGELVGSQTS TSTDRYAIDR SKGFLIFSDE DGETSAGYLG SFLFADRALS TDEVKALGGA       180
     SKEGVSKAAI AGASQFDFTD GTLNATFGTA TLQATGLTPT FGTPATLGIP AMPDASEVLT       240
     PGRANDFLVI AHRGAQAYRP EHTLEAYKLA IDMGADFIEP DLVSTKDGVL VARHDPWLAS       300
     VKLDAAGTIA RDANGKPIVT SQTTNVADIA KFADKLTVKD YAGGKVAGWF VSDFTLAEIK       360
     ELRAREDQPQ LRPGSASYDN QFQIPTLAEI IALVKQTEAD TGLTIGIYPE TKDPTFHKIQ       420
     GLDTSKMLID ALKEAGFIDP SRVFIQSFEF ANLIELKTKI MPAAGVNLPL VQLVYFQAPY       480
     VPDDVAYNFS GAPGADPSVY NVLGLNLSAT STYEAFTTPQ ALKTIANLYA SGLGPDMPFV       540
     IDAATGAPKQ LLLDVHAAGL KVHPYTHRDD AFGANSKSFI DALTKAGVDG VFTDNTDTVV       600
     NAVLAAQPVQ DAAGTFTGVP SLGGDPGVLH VPAPAKKTDG FVFDPAIDGT ATTYTMIFDV       660
     LVKTGDFAGD WNALFQTNLT NGDDAKFFMK KDGATFGIGK GDYHGSATLD TWHRIAVTLT       720
     ANGDGTSTMR KYIDGVEVGS SAYATADYTI DDKGVLLFAD NDGEGVPSHL NSFYFTDRAM       780
     TGDEIKALGG SKVGGVLAAA PAQGRATQFD FANGTLAASF GSGTMAAAAT VVPPEPAADK       840
     QAVVFGTPES LGLPALPGGQ DGVISAPSFD PDHGLELKPG FAPKNGSATF DTYTIVYDLY       900
     LPKQTGLGSI FQSDLSSRSD GDLWLGFRDD QAVLGTDSQD EGRITLDAWH RLAFSIERIS       960
     SDSFTLKKYV DGVKIGQQTV KNDFVIGDKG FLLFADDSNE TPKFSLSSVA FMEKTLSESE      1020
     VAALGGASAG GPFTAPIAGV NGVQFDFSKG EFSPSFGSGT LTARAPGVVE PPPPASVRVG      1080
     APIKDMLVTP TAANTVIDLA GVFAGNNLTY KVETAEGRVV NASVADGKLT LDFGGLGHSD      1140
     VRVTATDAAG NTAADAFRVR VAGPNAYTIA VLPDTQDYTD QNTANGPPET FYRMTEWLAA      1200
     HKDARKIQFV AHVGDVTQNN LPTEWVVAEK AMRTLDGKIP YSLLPGNHDQ ANGGTAANHS      1260
     SVNLDTLFSP EKQAATNPNT FRGVYDQEPT SSRNNYHTFT APDGTKWLIL SMEFGPRDDV      1320
     IRWASEVLDK HLDHRVMIIS HSLTDFASRH DAAGLGLYDE GTGADYGLRN DPQSVNDGET      1380
     VYRLLSAKYP NISFTFSGHI FGDGAETNVS YSQHGNPVYE MLVNYQNGIS REITGNGNEA      1440
     LGNRGGNGAI RLVTIDPDNR TLSTETYFTE FDDYLDGYRV KPELDRNGLT GSYRGHQEEF      1500
     GNVELGAPEL RAVAKAGDDL YLSAPAGADR LAVTLNASRT LDPAHDIASY VWRNADGDVI      1560
     ARGAKPTVDL AVGRHPLTLE VTDAKGHVTT DQKLVVVKGD ATLLVENFND GNAYGWVKPP      1620
     VPVKTLSTGT PAEFGLPALP GGEKKVAFVP ALPSNEGLRV TPNLGAPAGT RIASYSVIFD      1680
     ILVPPGQGDW TSLMQTDVAN KSDGDLFIRS NGNGTGGIGI SSNYTGSLQY GAWQRVAFTF      1740
     KEEADGTVTL NKFIEGVKVG SQSVSGDRFK LDVSQGALFF SDEDGEVSKL YVSSLLITDK      1800
     VYTEAEIAAL GGAKAGGIVA SAPTPLSVQF DFNDAGLRPS FGPAEMSFGS LDNTGSSGNF      1860
     VVKGSVFARP TAAEGQAAPE ARLYDQSDAK GNLLLWGDAT AKSWSDYAFE ATLQSTDNDA      1920
     IGLVFSYQDA QNHYRLTFNG KTNRRELVKV KDGVETVLAS AAKGQPFQTD MAVKVAVLDG      1980
     KISAFLNGSS IFDGVVKDAT DPLKGGTVGL YSSEQRSSMF DDLVVTKVKA LAHAGADQRA      2040
     IDFDGDGLAS VRLDAGASLG LADIVSYRWT DANGDEVATG IEPEVKLGLG SNALTLTVTD      2100
     ANGATATDRV DIDVMAKSQV LLNESFGSAE ALAKWRILDE GESGGVGPDG KSSQWELRDG      2160
     RLVQLSDLQS RQLEWQGGAT APNLWTRGWS PLGDGVNVLR RGTQAIYDDP AAKEWTDYSV      2220
     EATIKTLDND ALGFLIHYVD AKNYYKVELD AEGNYDRKAG NGAGSLFQIT RVRDGVEEVL      2280
     YQVPAKYEPG TEMRLRVDVI GGKISAFLDG EAIFAYPIED HAHPKGTVAL YSWGSEGVSF      2340
     DDVRVIAPGE AAPGNLQLSG GEGDDSLTGS AGNDTIRGGA GNDTLKGFAG ADQLFGQNGN      2400
     DTVWGGAGND FVSGGFGADS VSGDAGDDLV FSDDDDDVAD GGAGNDRVYG GTGADLVFGA      2460
     AGDDQVYGEW GNDFVSGGEG HDFVSGGFGN DEVNGDAGND LLFGDDGDDA VSGGEGDDRV      2520
     YGGTGNDLVS GEAGADQVFG EQGEDVLLGG AGSDYLSGGA GADQLFGGEG ADLLFGNAGA      2580
     DALTGGLGSD AFAFGRGDGQ DVIRDFVTGG AERDVIAFNN GAFGSFAAVQ AALRQEGSDA      2640
     VIAYGTGDTI TLQNVQATSL TAQNFTFA                                         2668
//

If you have problems or comments...

PBIL Back to PBIL home page