(data stored in ACNUC7421 zone)

EMBL: CP001349.PE475

CP001349.PE475       Location/Qualifiers
FT   CDS             548032..548916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0485"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_1695 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55527"
FT                   /db_xref="GOA:B8ICD9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55527.1"
FT                   /translation="MSISKLRAFHLVASAGGFTQAARQASVSQSGLSGQVRELEAASGL
FT                   HLFDRKPRGAVLSENGRELFAITTRLFEAEAEAQRFLRRAPRDGEAGHLRVAGDGPIVP
FT                   LAILQALKRSRPQLTFSLVIDNSDRVVEQVQNFRADVGVTATRPDTDQLHGVYLMSMKI
FT                   GLCVSRSHPLAGRRIAMRDLAGLALVLRERGSRTRAVLEANLAEHGVETGPVLEISTRD
FT                   GIREAVAGGLGCGVVADREFGHDSRLAFVPIVDARIGIDEYAITLAERRNQPLVRAFFD
FT                   GARSWRSEPPEMA"
     MSISKLRAFH LVASAGGFTQ AARQASVSQS GLSGQVRELE AASGLHLFDR KPRGAVLSEN        60
     GRELFAITTR LFEAEAEAQR FLRRAPRDGE AGHLRVAGDG PIVPLAILQA LKRSRPQLTF       120
     SLVIDNSDRV VEQVQNFRAD VGVTATRPDT DQLHGVYLMS MKIGLCVSRS HPLAGRRIAM       180
     RDLAGLALVL RERGSRTRAV LEANLAEHGV ETGPVLEIST RDGIREAVAG GLGCGVVADR       240
     EFGHDSRLAF VPIVDARIGI DEYAITLAER RNQPLVRAFF DGARSWRSEP PEMA             294
//

If you have problems or comments...

PBIL Back to PBIL home page