(data stored in ACNUC7421 zone)

EMBL: CP001349.PE476

CP001349.PE476       Location/Qualifiers
FT   CDS             complement(549204..550193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0486"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: met:M446_1694 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55528"
FT                   /db_xref="GOA:B8ICE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL55528.1"
FT                   /translation="MSAPVVEAKDLRQVYEIRRGFFRAPARLQAVGGVSFAVQPGRTLA
FT                   VVGESGCGKSTLARMVTLIEPPTAGSLTLDGIDAVDPPRADWRRLRRMVQLVFQNPYGS
FT                   LNPRRKVGAILEEPLAINTDLARPERTARARAMLAKVGLRPEHYDRYPHMFSGGQRQRI
FT                   AIARALMLSPKLVVADEPVSALDVSIQAQVLNLLADLQQELGLAYLFISHDLGVVRHIA
FT                   HDVLVMYLGLVMEQGEKGRIYAAPLHPYTQALLGATPGLTGAKRKRMVLGGDLPSPLSP
FT                   PKGCVFSTRCPYATDLCRAERPALRPLDGRLVACHYAETFLAEAPAAA"
     MSAPVVEAKD LRQVYEIRRG FFRAPARLQA VGGVSFAVQP GRTLAVVGES GCGKSTLARM        60
     VTLIEPPTAG SLTLDGIDAV DPPRADWRRL RRMVQLVFQN PYGSLNPRRK VGAILEEPLA       120
     INTDLARPER TARARAMLAK VGLRPEHYDR YPHMFSGGQR QRIAIARALM LSPKLVVADE       180
     PVSALDVSIQ AQVLNLLADL QQELGLAYLF ISHDLGVVRH IAHDVLVMYL GLVMEQGEKG       240
     RIYAAPLHPY TQALLGATPG LTGAKRKRMV LGGDLPSPLS PPKGCVFSTR CPYATDLCRA       300
     ERPALRPLDG RLVACHYAET FLAEAPAAA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page