(data stored in ACNUC7421 zone)

EMBL: CP001349.PE477

CP001349.PE477       Location/Qualifiers
FT   CDS             complement(550190..551212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0487"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: met:M446_1693 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55529"
FT                   /db_xref="GOA:B8ICE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL55529.1"
FT                   /translation="MPLLEIENLSVEFPSAGGVMRAVDGVSLSLEAGEVLGVVGESGSG
FT                   KSVTMLALMGLVAYPGRVRADRLRFEGRDLLTLSARERRRLTGKDVAMIFQEPTTSLNP
FT                   CFTVGFQLAETLRLHEGMGRRAARDRAVELLAQVGIPAPESRLGAYPHQLSGGMNQRVM
FT                   IAMAIACNPKLLIADEPTTALDVTIQAQILDLLLTLQRERGMALVLITHNMGVVAETAQ
FT                   RVIVMYAGQVMEEQKAAALFAAPQHPYTAALLAALPERSEGGRLATIPGVVPGLFDRPS
FT                   GCLFSPRCTDATEHSRRVRPELRACGEGRVRCHYPLGDPQRTARIAEDGRVGATEAVTS
FT                   "
     MPLLEIENLS VEFPSAGGVM RAVDGVSLSL EAGEVLGVVG ESGSGKSVTM LALMGLVAYP        60
     GRVRADRLRF EGRDLLTLSA RERRRLTGKD VAMIFQEPTT SLNPCFTVGF QLAETLRLHE       120
     GMGRRAARDR AVELLAQVGI PAPESRLGAY PHQLSGGMNQ RVMIAMAIAC NPKLLIADEP       180
     TTALDVTIQA QILDLLLTLQ RERGMALVLI THNMGVVAET AQRVIVMYAG QVMEEQKAAA       240
     LFAAPQHPYT AALLAALPER SEGGRLATIP GVVPGLFDRP SGCLFSPRCT DATEHSRRVR       300
     PELRACGEGR VRCHYPLGDP QRTARIAEDG RVGATEAVTS                             340
//

If you have problems or comments...

PBIL Back to PBIL home page