(data stored in ACNUC7421 zone)

EMBL: CP001349.PE478

CP001349.PE478       Location/Qualifiers
FT   CDS             complement(551217..552128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0488"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1692
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55530"
FT                   /db_xref="GOA:B8ICE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55530.1"
FT                   /translation="MTAEVMETPSAAAPSATPPHPLKEFWSYFRANTGAVIGLAVIVLV
FT                   LALAALADVVAPHSPTLTNEAMFLKPPFWQQGGSLAYPLGTDAIGRDILSRLIHGARLS
FT                   LTIGIAVVALSILVGTALGLAAGYFRGIVDIAIMRVMDIILTLPSLLLAIVIVAILGPG
FT                   LMNAMLAVAVVVLPHYVRIARAAVLAEASRDYVTAAKVSGAGTLRLMFKEILPNCMAPL
FT                   IVQASLGISTAILDAAALGFLGLGAQPPAPEWGTMLADAREFVLRAWWVVTFPGLMILI
FT                   TVLAFNLLGDGLRDAFDPKLKR"
     MTAEVMETPS AAAPSATPPH PLKEFWSYFR ANTGAVIGLA VIVLVLALAA LADVVAPHSP        60
     TLTNEAMFLK PPFWQQGGSL AYPLGTDAIG RDILSRLIHG ARLSLTIGIA VVALSILVGT       120
     ALGLAAGYFR GIVDIAIMRV MDIILTLPSL LLAIVIVAIL GPGLMNAMLA VAVVVLPHYV       180
     RIARAAVLAE ASRDYVTAAK VSGAGTLRLM FKEILPNCMA PLIVQASLGI STAILDAAAL       240
     GFLGLGAQPP APEWGTMLAD AREFVLRAWW VVTFPGLMIL ITVLAFNLLG DGLRDAFDPK       300
     LKR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page