(data stored in ACNUC7421 zone)

EMBL: CP001349.PE479

CP001349.PE479       Location/Qualifiers
FT   CDS             complement(552169..553179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0489"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1691 alkaline
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55531"
FT                   /db_xref="GOA:B8ICE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55531.1"
FT                   /translation="MLRFLLTRLSLIVPTFIGITLVAFFLIRLVPGDPIETMAGERGID
FT                   PARHEALRHELGLDRPILVQYGIYLGRLLQGDLGKSMITQETVINEFASLFPATVELAV
FT                   CAILFAVLLGLPAGILAAVRRNSIFDHGVMGLSLAGYSMPIFWWGLLLILLFSVQLDLT
FT                   PVSGRIAVQYYVEPVTGFLLIDSLLSDDRGAFGSALAHLVLPAIVLGTVPLAVIARMTR
FT                   SAMLEVLGEDYIRTARAKGLSGMRVIGLHALRNALIPVVTVIGLQVGVLFTGAILTETI
FT                   FSWPGIGKWLIEAIGRRDYPVLQGGILLIGAVVMTVNLLVDLAYGLINPRIRHMR"
     MLRFLLTRLS LIVPTFIGIT LVAFFLIRLV PGDPIETMAG ERGIDPARHE ALRHELGLDR        60
     PILVQYGIYL GRLLQGDLGK SMITQETVIN EFASLFPATV ELAVCAILFA VLLGLPAGIL       120
     AAVRRNSIFD HGVMGLSLAG YSMPIFWWGL LLILLFSVQL DLTPVSGRIA VQYYVEPVTG       180
     FLLIDSLLSD DRGAFGSALA HLVLPAIVLG TVPLAVIARM TRSAMLEVLG EDYIRTARAK       240
     GLSGMRVIGL HALRNALIPV VTVIGLQVGV LFTGAILTET IFSWPGIGKW LIEAIGRRDY       300
     PVLQGGILLI GAVVMTVNLL VDLAYGLINP RIRHMR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page