(data stored in ACNUC7421 zone)

EMBL: CP001349.PE48

CP001349.PE48        Location/Qualifiers
FT   CDS             complement(54826..56358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0049"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mex:Mext_2140 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55100"
FT                   /db_xref="GOA:B8IU55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU55"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55100.1"
FT                   /translation="MAEDAGRTIEALMRAGAEGATALDAPGGTPLSFGALRALMRRIVQ
FT                   DLNAHGVGRGDRVAIVLDNGPAMAAAFIAIAAGATSAPLNPTYRAEEFEFYLTDLKARV
FT                   LVTAEGSTSPAIAVAEKLGVPVVRLRETPEHGAGSFTLRFPAPAAPAAQGGPAEPGDVA
FT                   LVLHTSGTTSRPKIVPLTQCNVCASARNIRTALAFGPQDRGLNIMPLFHIHGLIAGILA
FT                   PLSAGGSVACTPGFNALKFFAWMDEVGPTWYTAVPTMHQAILARAGRNREIIARHPLRF
FT                   LRSSSSSMPPQVLRELEAVFDAPLIEAYGMTEAAHQMASNPLPPRARKAGSVGLAAGPD
FT                   IQVVDEAGNPLPAGETGEIVIRGDNVMAGYENNPKANAEAFTPQGYFRTGDQGVMDEEG
FT                   YLAITGRLKEIINRGGEKISPREVDEILMDHPSVAQVVTFAVPHDKLGEEVGAAVVLRD
FT                   GQHVDDKELRAFVAERAAAFKVPSRIMILDEIPKGATGKLQRIGLARKLGLA"
     MAEDAGRTIE ALMRAGAEGA TALDAPGGTP LSFGALRALM RRIVQDLNAH GVGRGDRVAI        60
     VLDNGPAMAA AFIAIAAGAT SAPLNPTYRA EEFEFYLTDL KARVLVTAEG STSPAIAVAE       120
     KLGVPVVRLR ETPEHGAGSF TLRFPAPAAP AAQGGPAEPG DVALVLHTSG TTSRPKIVPL       180
     TQCNVCASAR NIRTALAFGP QDRGLNIMPL FHIHGLIAGI LAPLSAGGSV ACTPGFNALK       240
     FFAWMDEVGP TWYTAVPTMH QAILARAGRN REIIARHPLR FLRSSSSSMP PQVLRELEAV       300
     FDAPLIEAYG MTEAAHQMAS NPLPPRARKA GSVGLAAGPD IQVVDEAGNP LPAGETGEIV       360
     IRGDNVMAGY ENNPKANAEA FTPQGYFRTG DQGVMDEEGY LAITGRLKEI INRGGEKISP       420
     REVDEILMDH PSVAQVVTFA VPHDKLGEEV GAAVVLRDGQ HVDDKELRAF VAERAAAFKV       480
     PSRIMILDEI PKGATGKLQR IGLARKLGLA                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page