(data stored in ACNUC7421 zone)

EMBL: CP001349.PE480

CP001349.PE480       Location/Qualifiers
FT   CDS             complement(553225..554820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0490"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1690 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55532"
FT                   /db_xref="GOA:B8ICE4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE4"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55532.1"
FT                   /translation="MKTTILLAAVAGAAVLAAPLQAKTLVYCSEGSPENFYPAINTTGT
FT                   TFDATAQVYNNLVEFERGGTKVVPGLAESWEISPDGTAYTFHLRKGVKWHNANRAFKPT
FT                   RDFNADDVVFAIERQWKEDHPFYKVTSSNHSYFNDMGLAKLLKSVERLDDHTVRITLNR
FT                   PEAPFLADLAMSYAGIQSKEYADAMLKAGTPEKIDQVPIGTGPFYLVQYQKDAIIRYKA
FT                   FPEYWGGKAKIDDLVFAITPDASVRWAKLQKGECHLMPYPNPADLDAMRKDPAIQVLEQ
FT                   PGLNIGYLAYNTTKKPFDDVRVRKAFNMAINKKAIIEAVYLSTGIAAVNPIPPSIWSYN
FT                   TAVKDDPYDPEAARKLLAEAGFPNGFETDLWAMPVQRPYNPNARRIAELMQADLAKVGI
FT                   KAEIKSYEWGEYRKRMQAGEHQTGMLGWTGDNGDPDNFLHTLLGCDAAKNNGGNVAKWC
FT                   DKTFDDVVVKAKMLTDQAERTKLYEQAQVVFKEQAPWFTIAHAVQLKPMRKEVIDFKLS
FT                   PFSRHVFYGVDIKG"
     MKTTILLAAV AGAAVLAAPL QAKTLVYCSE GSPENFYPAI NTTGTTFDAT AQVYNNLVEF        60
     ERGGTKVVPG LAESWEISPD GTAYTFHLRK GVKWHNANRA FKPTRDFNAD DVVFAIERQW       120
     KEDHPFYKVT SSNHSYFNDM GLAKLLKSVE RLDDHTVRIT LNRPEAPFLA DLAMSYAGIQ       180
     SKEYADAMLK AGTPEKIDQV PIGTGPFYLV QYQKDAIIRY KAFPEYWGGK AKIDDLVFAI       240
     TPDASVRWAK LQKGECHLMP YPNPADLDAM RKDPAIQVLE QPGLNIGYLA YNTTKKPFDD       300
     VRVRKAFNMA INKKAIIEAV YLSTGIAAVN PIPPSIWSYN TAVKDDPYDP EAARKLLAEA       360
     GFPNGFETDL WAMPVQRPYN PNARRIAELM QADLAKVGIK AEIKSYEWGE YRKRMQAGEH       420
     QTGMLGWTGD NGDPDNFLHT LLGCDAAKNN GGNVAKWCDK TFDDVVVKAK MLTDQAERTK       480
     LYEQAQVVFK EQAPWFTIAH AVQLKPMRKE VIDFKLSPFS RHVFYGVDIK G                531
//

If you have problems or comments...

PBIL Back to PBIL home page