(data stored in ACNUC7421 zone)

EMBL: CP001349.PE481

CP001349.PE481       Location/Qualifiers
FT   CDS             555014..557503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0491"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: met:M446_1689 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT domain
FT                   protein; NAD-dependent DNA ligase OB-fold; NAD-dependent
FT                   DNA ligase adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1; NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55533"
FT                   /db_xref="GOA:B8ICE5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICE5"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACL55533.1"
FT                   /translation="MPAQTSRARPVEEMTAAQAREAHESLSAEIAEHDRRYHGEDAPII
FT                   SDAEYDALRRRLEAIEERFPELAGTGAASVSVGAKASDKFAKVRHAVPMLSLGNAFAEE
FT                   EITEFVERVRRFLGLPASEPLAFTAEPKIDGLSLSLRYEGGRLVTAATRGDGEVGEDVT
FT                   ANVRTIREIPHELAGDDVPEICEVRGEVYLSHADFAAINARQEEAGRPLFANPRNAAAG
FT                   SLRQLDPGITASRPLRFFAYAAGEMSSWPAETQSGLIGAFRRFGLPVNPRTKRCTSVAE
FT                   MLAHYRAIETERAELGYDIDGVVYKVDEFALQRRLGFVARAPRWALAHKFPAQRAVTVI
FT                   EAIEINVGRTGSLNPLARLKPVTVGGVVVSNATLHNEDYIRGIDADGNTIRSGINIWDG
FT                   FRLREDVDLRQGSDVRVGDTVVVLRAGDVIPKVADVVLERRPADAVPYAFPETCPACGS
FT                   HAVRAYNPRTGKLDSVRRCTGGLICPAQGQERLRHFVSRNAFDIEGFGETYIATLFEAG
FT                   LVRQPADLFRLDFEPLKAAIVARRQALSAERALAAGKTPEAKKAKPKANEEDKAIHNLL
FT                   AAVEARRTIPLNRFIFALGIEQVGEATAKALAKHFPDMPALMEGVRAAAACRPGPDWIE
FT                   LASLPRVGPTTRERLLAAAEAGETDLLADGAVTRLTSAQKEALLAAYGDRDGLRNAVER
FT                   ALRQKPGDAYRHLADDSEIGAVTTASLIEFFSEAHNVEAVEALLREVRTERAGTPAAAA
FT                   VFSGQTVVFTGSLERMTRSEAKATAERLGAKVSGSVSAKTDLVVAGPGAGSKLKDAEKH
FT                   GVRVISEAEWLAMVEAA"
     MPAQTSRARP VEEMTAAQAR EAHESLSAEI AEHDRRYHGE DAPIISDAEY DALRRRLEAI        60
     EERFPELAGT GAASVSVGAK ASDKFAKVRH AVPMLSLGNA FAEEEITEFV ERVRRFLGLP       120
     ASEPLAFTAE PKIDGLSLSL RYEGGRLVTA ATRGDGEVGE DVTANVRTIR EIPHELAGDD       180
     VPEICEVRGE VYLSHADFAA INARQEEAGR PLFANPRNAA AGSLRQLDPG ITASRPLRFF       240
     AYAAGEMSSW PAETQSGLIG AFRRFGLPVN PRTKRCTSVA EMLAHYRAIE TERAELGYDI       300
     DGVVYKVDEF ALQRRLGFVA RAPRWALAHK FPAQRAVTVI EAIEINVGRT GSLNPLARLK       360
     PVTVGGVVVS NATLHNEDYI RGIDADGNTI RSGINIWDGF RLREDVDLRQ GSDVRVGDTV       420
     VVLRAGDVIP KVADVVLERR PADAVPYAFP ETCPACGSHA VRAYNPRTGK LDSVRRCTGG       480
     LICPAQGQER LRHFVSRNAF DIEGFGETYI ATLFEAGLVR QPADLFRLDF EPLKAAIVAR       540
     RQALSAERAL AAGKTPEAKK AKPKANEEDK AIHNLLAAVE ARRTIPLNRF IFALGIEQVG       600
     EATAKALAKH FPDMPALMEG VRAAAACRPG PDWIELASLP RVGPTTRERL LAAAEAGETD       660
     LLADGAVTRL TSAQKEALLA AYGDRDGLRN AVERALRQKP GDAYRHLADD SEIGAVTTAS       720
     LIEFFSEAHN VEAVEALLRE VRTERAGTPA AAAVFSGQTV VFTGSLERMT RSEAKATAER       780
     LGAKVSGSVS AKTDLVVAGP GAGSKLKDAE KHGVRVISEA EWLAMVEAA                   829
//

If you have problems or comments...

PBIL Back to PBIL home page