(data stored in ACNUC7421 zone)

EMBL: CP001349.PE483

CP001349.PE483       Location/Qualifiers
FT   CDS             558449..559831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0493"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   met:M446_1685 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55535"
FT                   /db_xref="GOA:B8ICE7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE7"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACL55535.1"
FT                   /translation="MTPSTTFAGRTLALFGLGGSGLATALSLQAGGARVVACDDNPERM
FT                   AAAEAEGVATADLRGADWAEFAALLLAPGVPFTHPEPHWTVKRAASAGVPVIGDIELFC
FT                   RERATTAPDAPFVAITGTNGKSTTTALIAHVLRETGHDVQMGGNIGTAILSLAPPAPGR
FT                   VHVIEMSSFQIDLTPTLKPSVGVLLNITPDHLDRHGDMANYAGIKERLIASSDHAVIGV
FT                   DDDYTRAIAARHAGPLTRVHVGETAPGPGILARHGVLIDGCTEPPSPVADLTGIPSLRG
FT                   SHNWQNAGIAYAVARALGVAPDAFAQALRSFPGLPHRMEEVGRRGSVLFINDSKATNAD
FT                   STEKALAAFPRVHWILGGKPKEGGIASLAPYFPRIAHAYLIGAASDAFAATLEGHAPVS
FT                   RCGTLEAAVAQAAEDAAHEPEAVVLLSPACASYDQFRSFEDRGDQFRAMVRALPGLVPT
FT                   GG"
     MTPSTTFAGR TLALFGLGGS GLATALSLQA GGARVVACDD NPERMAAAEA EGVATADLRG        60
     ADWAEFAALL LAPGVPFTHP EPHWTVKRAA SAGVPVIGDI ELFCRERATT APDAPFVAIT       120
     GTNGKSTTTA LIAHVLRETG HDVQMGGNIG TAILSLAPPA PGRVHVIEMS SFQIDLTPTL       180
     KPSVGVLLNI TPDHLDRHGD MANYAGIKER LIASSDHAVI GVDDDYTRAI AARHAGPLTR       240
     VHVGETAPGP GILARHGVLI DGCTEPPSPV ADLTGIPSLR GSHNWQNAGI AYAVARALGV       300
     APDAFAQALR SFPGLPHRME EVGRRGSVLF INDSKATNAD STEKALAAFP RVHWILGGKP       360
     KEGGIASLAP YFPRIAHAYL IGAASDAFAA TLEGHAPVSR CGTLEAAVAQ AAEDAAHEPE       420
     AVVLLSPACA SYDQFRSFED RGDQFRAMVR ALPGLVPTGG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page