(data stored in ACNUC7421 zone)

EMBL: CP001349.PE484

CP001349.PE484       Location/Qualifiers
FT   CDS             559951..560730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0494"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   met:M446_1684 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55536"
FT                   /db_xref="GOA:B8ICE8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACL55536.1"
FT                   /translation="MLNHPHLLPAGGAPIQVPVHRAPRKIISWNLLRRSGATVEAVAAL
FT                   IEHEKPDLLLMQEATVEITDLQERVGGHYAWAPLPRRIHGLAMWSPTPWLSTPRVIPIP
FT                   SGALVDRVCQVLDCGTYGVANVHLSHGQMLNRRQLRRIEQHLPVRAAVLGDYNLVGPAL
FT                   LPGFRDVGPRHPTHAMVEIVPLRLDRCLVRGLICRHTAVLPRGASDHRPIVVHLEPSSL
FT                   PLSRPGIAHLRDRVDLRGMAAAIARRRRAGAPASPLP"
     MLNHPHLLPA GGAPIQVPVH RAPRKIISWN LLRRSGATVE AVAALIEHEK PDLLLMQEAT        60
     VEITDLQERV GGHYAWAPLP RRIHGLAMWS PTPWLSTPRV IPIPSGALVD RVCQVLDCGT       120
     YGVANVHLSH GQMLNRRQLR RIEQHLPVRA AVLGDYNLVG PALLPGFRDV GPRHPTHAMV       180
     EIVPLRLDRC LVRGLICRHT AVLPRGASDH RPIVVHLEPS SLPLSRPGIA HLRDRVDLRG       240
     MAAAIARRRR AGAPASPLP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page