(data stored in ACNUC7421 zone)

EMBL: CP001349.PE485

CP001349.PE485       Location/Qualifiers
FT   CDS             complement(560663..562099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0495"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   met:M446_1683 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55537"
FT                   /db_xref="GOA:B8ICE9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE9"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACL55537.1"
FT                   /translation="MQELVTAWFGLLSAVRVEGLALLGFALAFAVTLHALLNKREVGAA
FT                   IGWIGLAWLSPLAGSALYALFGINRVMRRARRLPVLPVRKPGVPQADPVRVPEPFLPLE
FT                   RAGDELTGLPLTGGNRVALLRHGDEAYPAMLEAIGTAQHSIGLSSYIMRDDASGEAFVR
FT                   ALAAAKARGTAICVLVDGIGSGYFSPAIYRRLRAEGIPAGLFMHSAVPWRMPFLNLRTH
FT                   KKLLVVDGRIGFVGGVNIGDENRVSQNPPEPVRDTHFRLDGPVVGQLTQAFARDWAFVM
FT                   GEDLDGPAWFPAIPPAGAIPARVVTSGPDADIEKIEFVVLAALATARRSIRLATPYFLP
FT                   SEILLTSLALAAMRGIAVDVVIPQASNHRLVDWATRAHVGPLLKSGVRIWLDRPPFDHS
FT                   KLMVVDDVWCFVGSANWDTRSFRLNFELNVELYDPAFAAQLDRLLAAKMETQLTREALK
FT                   ARGMPVRLRDAGVRLLLPYL"
     MQELVTAWFG LLSAVRVEGL ALLGFALAFA VTLHALLNKR EVGAAIGWIG LAWLSPLAGS        60
     ALYALFGINR VMRRARRLPV LPVRKPGVPQ ADPVRVPEPF LPLERAGDEL TGLPLTGGNR       120
     VALLRHGDEA YPAMLEAIGT AQHSIGLSSY IMRDDASGEA FVRALAAAKA RGTAICVLVD       180
     GIGSGYFSPA IYRRLRAEGI PAGLFMHSAV PWRMPFLNLR THKKLLVVDG RIGFVGGVNI       240
     GDENRVSQNP PEPVRDTHFR LDGPVVGQLT QAFARDWAFV MGEDLDGPAW FPAIPPAGAI       300
     PARVVTSGPD ADIEKIEFVV LAALATARRS IRLATPYFLP SEILLTSLAL AAMRGIAVDV       360
     VIPQASNHRL VDWATRAHVG PLLKSGVRIW LDRPPFDHSK LMVVDDVWCF VGSANWDTRS       420
     FRLNFELNVE LYDPAFAAQL DRLLAAKMET QLTREALKAR GMPVRLRDAG VRLLLPYL         478
//

If you have problems or comments...

PBIL Back to PBIL home page