(data stored in ACNUC7421 zone)

EMBL: CP001349.PE486

CP001349.PE486       Location/Qualifiers
FT   CDS             complement(562242..563528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0496"
FT                   /product="putative glucose/sorbosone dehydrogenase"
FT                   /note="KEGG: met:M446_1682 putative glucose/sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55538"
FT                   /db_xref="GOA:B8ICF0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF0"
FT                   /inference="similar to AA sequence:KEGG:M446_1682"
FT                   /protein_id="ACL55538.1"
FT                   /translation="MRSGLIAALTAGATLAASVSLASLAAAQEAGDTKAKVDNLEKLQG
FT                   FRTTGVAEPPPIPQTGRRADAINRTLQKIKLPEGFKISLYAIVPDARAMAVGPNAGVVF
FT                   VGTRKSKVYTVTDRAKDRVADEVKVFAPAIDFKIPNGVCFSRDGVLTVVEQNRVLAFPA
FT                   AEFFYEGPDVAASVVVKQGELIPVSEESYNHTARVCRIGPDGKLYIALGQPYNVPPKEK
FT                   AELYARTGIGGIIRMDADGKNREVFATGIRNSVGMDFAPDKTLWFTDNQVDGMGDDQPP
FT                   GELNQATKPGQNFGFPWYGGGAVRTVEYKNDTVPPDVVPPKAELAPHAADLGMIVYRGK
FT                   MFPEKYRGGVFTAEHGSWNRTTPIGARVMFVPITKDGTAGRPEPFAEGWLTESGEYLGR
FT                   PVDVATLPDGSLLVSDDTAGAIYRIAYEK"
     MRSGLIAALT AGATLAASVS LASLAAAQEA GDTKAKVDNL EKLQGFRTTG VAEPPPIPQT        60
     GRRADAINRT LQKIKLPEGF KISLYAIVPD ARAMAVGPNA GVVFVGTRKS KVYTVTDRAK       120
     DRVADEVKVF APAIDFKIPN GVCFSRDGVL TVVEQNRVLA FPAAEFFYEG PDVAASVVVK       180
     QGELIPVSEE SYNHTARVCR IGPDGKLYIA LGQPYNVPPK EKAELYARTG IGGIIRMDAD       240
     GKNREVFATG IRNSVGMDFA PDKTLWFTDN QVDGMGDDQP PGELNQATKP GQNFGFPWYG       300
     GGAVRTVEYK NDTVPPDVVP PKAELAPHAA DLGMIVYRGK MFPEKYRGGV FTAEHGSWNR       360
     TTPIGARVMF VPITKDGTAG RPEPFAEGWL TESGEYLGRP VDVATLPDGS LLVSDDTAGA       420
     IYRIAYEK                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page