(data stored in ACNUC7421 zone)

EMBL: CP001349.PE487

CP001349.PE487       Location/Qualifiers
FT   CDS             complement(563629..565074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0497"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: met:M446_1681 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55539"
FT                   /db_xref="GOA:B8ICF1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF1"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55539.1"
FT                   /translation="MTLPSDLVTLHATDLAQAIRSRAVSAREVMQAHLDQIARFNPAVT
FT                   AIVSLRDPELLLAEAEAADRDLAAGRWRGPLHGLPHAVKDTSPAQGMPWTQGSPVFRSR
FT                   MPEADAPYVARLRQAGAILIGKTNVPEFGLGSHTVNPVFGPTRNAYDPGRSAGGSSGGA
FT                   AVALALRMLPLADGSDHAGSLRNPAAWNGVLGLRPSPGRVPLRTDEVFLPDLTVAGPMA
FT                   RCTADLGLLLSVMAGPDPRLPQAIQEDPAPFARPQPRDLPGLRVGWLGDCGGHLATEPG
FT                   VLDLCEQGLAVLEARGARVEPLALGLDPEEVWQAWRVLRAWLAGGAQAPLWRDPQTRAA
FT                   LKPEAAWEVEEGLKLDAFAILEASAMRSRWYAQVLRLFETVDLLALPAAQVFPFPIEEA
FT                   WPRRIAGRDMDTYHRWMEVTIPATMAGCPAISLPAGRNQGGLPMGLQLIAPHRGEAALL
FT                   SVAAAYEEATAFDRMLPPPLTAP"
     MTLPSDLVTL HATDLAQAIR SRAVSAREVM QAHLDQIARF NPAVTAIVSL RDPELLLAEA        60
     EAADRDLAAG RWRGPLHGLP HAVKDTSPAQ GMPWTQGSPV FRSRMPEADA PYVARLRQAG       120
     AILIGKTNVP EFGLGSHTVN PVFGPTRNAY DPGRSAGGSS GGAAVALALR MLPLADGSDH       180
     AGSLRNPAAW NGVLGLRPSP GRVPLRTDEV FLPDLTVAGP MARCTADLGL LLSVMAGPDP       240
     RLPQAIQEDP APFARPQPRD LPGLRVGWLG DCGGHLATEP GVLDLCEQGL AVLEARGARV       300
     EPLALGLDPE EVWQAWRVLR AWLAGGAQAP LWRDPQTRAA LKPEAAWEVE EGLKLDAFAI       360
     LEASAMRSRW YAQVLRLFET VDLLALPAAQ VFPFPIEEAW PRRIAGRDMD TYHRWMEVTI       420
     PATMAGCPAI SLPAGRNQGG LPMGLQLIAP HRGEAALLSV AAAYEEATAF DRMLPPPLTA       480
     P                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page