(data stored in ACNUC7421 zone)

EMBL: CP001349.PE49

CP001349.PE49        Location/Qualifiers
FT   CDS             complement(56404..57411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0050"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   KEGG: mpo:Mpop_2099 2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55101"
FT                   /db_xref="GOA:B8IU56"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU56"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACL55101.1"
FT                   /translation="MSIAIVGAGAIGGYLGVRLAAAGESVTFIARGANLEAIRRTGMRL
FT                   IEEDGREVHVRDLRATASMQEAGPHDVVLLTLKAHQVGPIAQDLKHLIGPRTVVVTMQN
FT                   GIPWWYFHKHGGEYAGTQLETADPGGLIAAAIDPEQVIGSVVYPAAILTEPGVVKVVEG
FT                   SRFGLGELSGEMSERVQALAQLLIKAGFKAPVTNDIRAEIWLKLWGNLSFNPISALTHA
FT                   TLVDICQFPETRALASEMMREAETIANTLGITFRLGIERRIAGAEKVGAHKTSMLQDVE
FT                   AGRPIELEALVGSVIELGRLTKTPTPHIDAVYACMRLLARTLEQQKGRLQVQPV"
     MSIAIVGAGA IGGYLGVRLA AAGESVTFIA RGANLEAIRR TGMRLIEEDG REVHVRDLRA        60
     TASMQEAGPH DVVLLTLKAH QVGPIAQDLK HLIGPRTVVV TMQNGIPWWY FHKHGGEYAG       120
     TQLETADPGG LIAAAIDPEQ VIGSVVYPAA ILTEPGVVKV VEGSRFGLGE LSGEMSERVQ       180
     ALAQLLIKAG FKAPVTNDIR AEIWLKLWGN LSFNPISALT HATLVDICQF PETRALASEM       240
     MREAETIANT LGITFRLGIE RRIAGAEKVG AHKTSMLQDV EAGRPIELEA LVGSVIELGR       300
     LTKTPTPHID AVYACMRLLA RTLEQQKGRL QVQPV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page