(data stored in ACNUC7421 zone)

EMBL: CP001349.PE490

CP001349.PE490       Location/Qualifiers
FT   CDS             complement(565785..566216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55542"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF4"
FT                   /inference="similar to AA sequence:KEGG:M446_1940"
FT                   /protein_id="ACL55542.1"
FT                   /translation="MMRWLGLVSAVLAAGGPEPVRLRPGAYEVEVRLDLPHLDEAGARK
FT                   IVRLCLAGLPAQGFPVLSDNTPFAHCPATGLRQEGEAVHFAIQCEGRNAGQGSAIYRLA
FT                   PEGFEGRIALRLGGKNMTLTELQTGRWRGECAPGDRPLP"
     MMRWLGLVSA VLAAGGPEPV RLRPGAYEVE VRLDLPHLDE AGARKIVRLC LAGLPAQGFP        60
     VLSDNTPFAH CPATGLRQEG EAVHFAIQCE GRNAGQGSAI YRLAPEGFEG RIALRLGGKN       120
     MTLTELQTGR WRGECAPGDR PLP                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page