(data stored in ACNUC7421 zone)

EMBL: CP001349.PE491

CP001349.PE491       Location/Qualifiers
FT   CDS             566399..567523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0501"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; Ada metal-binding domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: met:M446_1042 AraC
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55543"
FT                   /db_xref="GOA:B8ICF5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF5"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACL55543.1"
FT                   /translation="MKLPDPDPPVMRPDEAACRAALARRDPAADGTFVYAVRTTGVYCR
FT                   PSCPARTARPENVSFYATCAEAEAAGFRPCRRCRPNEPGLAARQAEAVARACRLIEEAE
FT                   TPPSLDALSRTEGLSPYHFHRIFKRITGVTPKAYAAARRAARLESGLLRDAGTVTEAIF
FT                   EAGYGTSSRFYAAAAARLGMTPTAYRRGGAGTAIRFAVAACSLGAVLVAATQKGVCAIM
FT                   LGDDPEALVRDLQDRFPRAELTGGDAEFETVVAQVVGLVEAPGTARFDLPLDINGTAFQ
FT                   QRVWQALRAIPPGRTATYTQIAQAIGEPKAVRAVAQACGANPLAVAIPCHRVVRHDGAL
FT                   SGYRWGVARKRDLLARESTTTRDEAQGDLALDGK"
     MKLPDPDPPV MRPDEAACRA ALARRDPAAD GTFVYAVRTT GVYCRPSCPA RTARPENVSF        60
     YATCAEAEAA GFRPCRRCRP NEPGLAARQA EAVARACRLI EEAETPPSLD ALSRTEGLSP       120
     YHFHRIFKRI TGVTPKAYAA ARRAARLESG LLRDAGTVTE AIFEAGYGTS SRFYAAAAAR       180
     LGMTPTAYRR GGAGTAIRFA VAACSLGAVL VAATQKGVCA IMLGDDPEAL VRDLQDRFPR       240
     AELTGGDAEF ETVVAQVVGL VEAPGTARFD LPLDINGTAF QQRVWQALRA IPPGRTATYT       300
     QIAQAIGEPK AVRAVAQACG ANPLAVAIPC HRVVRHDGAL SGYRWGVARK RDLLARESTT       360
     TRDEAQGDLA LDGK                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page