(data stored in ACNUC7421 zone)

EMBL: CP001349.PE493

CP001349.PE493       Location/Qualifiers
FT   CDS             complement(568944..569966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_1710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55545"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF7"
FT                   /inference="similar to AA sequence:KEGG:RPD_1710"
FT                   /protein_id="ACL55545.1"
FT                   /translation="MQRHGLPALMLFCALTAVTGVAGAKDAETWRVEGKLVGKDKKSKD
FT                   VSGIACAPANGGQARKCLVIDDNLQAAQIVELHADHLKTDKDQKVPLIRNEFGGEALEL
FT                   DGEGVAYADGLFYVIGSHGHPRDKKGKLKSAEHADMVAARIAAASQIVRVRLSPEGKGS
FT                   VVPPVASLTRAIEAEPALAPFAGRRLENDGVTIEGIAVRGDRLYAGFRGPPLDNGRAAV
FT                   LAVDLGSAFGEAPAKPSRLFRLPVGERRGVRDLAVHGTKILVLVGPVGDEPGPSSIYEW
FT                   DGESDEAIRSLGDLGALAGVSPKQKPEAILPLDTTPSGLRVLVMFDGEEEGAPIVVTLP
FT                   "
     MQRHGLPALM LFCALTAVTG VAGAKDAETW RVEGKLVGKD KKSKDVSGIA CAPANGGQAR        60
     KCLVIDDNLQ AAQIVELHAD HLKTDKDQKV PLIRNEFGGE ALELDGEGVA YADGLFYVIG       120
     SHGHPRDKKG KLKSAEHADM VAARIAAASQ IVRVRLSPEG KGSVVPPVAS LTRAIEAEPA       180
     LAPFAGRRLE NDGVTIEGIA VRGDRLYAGF RGPPLDNGRA AVLAVDLGSA FGEAPAKPSR       240
     LFRLPVGERR GVRDLAVHGT KILVLVGPVG DEPGPSSIYE WDGESDEAIR SLGDLGALAG       300
     VSPKQKPEAI LPLDTTPSGL RVLVMFDGEE EGAPIVVTLP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page