(data stored in ACNUC7421 zone)

EMBL: CP001349.PE495

CP001349.PE495       Location/Qualifiers
FT   CDS             571031..573421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0506"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: met:M446_1046 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55547"
FT                   /db_xref="GOA:B8ICF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF9"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACL55547.1"
FT                   /translation="MPRPPRDWLDIGSEPSTGGAAGAPPPRLAERARAARDHVRTGLGA
FT                   VRAAAARAAAHPAARRAAAGAAAAWRPVRRGAARIPWGRTIAGTLALAALLIAGLVVYA
FT                   LATLPVNGGLAIEPTASALVVRAEGGQAFATRGVIKGAKLNPREVPKVLAEAIVAIEDR
FT                   RFYAHHGIDLRGLARAAFRNLAAGGTREGGSTLTQQLVRMSYLSQDRTLKRKVQEAILA
FT                   LWLESQLPKEEILTRYLNAAYFGAGVYGADAAAQRYFGKPARDLSLSEAAMLAGLVRAP
FT                   SQLAPHRNLDGARGRAAQVLEAMVETGAITPAEAEAARRNPAAVQVPTDTPVGTNYFVD
FT                   MVADQAKALIGAGPADASLRTTLDLTLQNIAESVLARRLDQDGERRKVSQGALVAMATD
FT                   GAILAMVGGRDYAESQFNRVTQARRQPGSIFKLFVYLTALRNGYRPDSVMMDRPTQVGE
FT                   WEPENYGGRYRGAVTLRSAFAQSINTVAVQLAEAVGIPAVIETAKALGVQSDLPNLPSL
FT                   ALGSAETTLLELTRAYAAVAAGAESVEPYAIRQIASRDQILYTRPATALPPARDTAARA
FT                   GMLDLLAAVMREGTGKGARVAVPAGGKTGTTQDNRDAWFIGFAGDLVVGVWLGNDDNAP
FT                   MQGVTGGDLPAAIWRDFVTQALAVRGRAAKAQAARPERPPPRSEMAAADPDADQRPGRG
FT                   SLRGTPSVIDTGTLNLDGQTVRLLGVEGLAGRNARELGRYLRRRDVACLPAEGGAYRCS
FT                   LDGQDLSELILFNGGGRAGADATPDLLAAEEQARSNRIGIWRR"
     MPRPPRDWLD IGSEPSTGGA AGAPPPRLAE RARAARDHVR TGLGAVRAAA ARAAAHPAAR        60
     RAAAGAAAAW RPVRRGAARI PWGRTIAGTL ALAALLIAGL VVYALATLPV NGGLAIEPTA       120
     SALVVRAEGG QAFATRGVIK GAKLNPREVP KVLAEAIVAI EDRRFYAHHG IDLRGLARAA       180
     FRNLAAGGTR EGGSTLTQQL VRMSYLSQDR TLKRKVQEAI LALWLESQLP KEEILTRYLN       240
     AAYFGAGVYG ADAAAQRYFG KPARDLSLSE AAMLAGLVRA PSQLAPHRNL DGARGRAAQV       300
     LEAMVETGAI TPAEAEAARR NPAAVQVPTD TPVGTNYFVD MVADQAKALI GAGPADASLR       360
     TTLDLTLQNI AESVLARRLD QDGERRKVSQ GALVAMATDG AILAMVGGRD YAESQFNRVT       420
     QARRQPGSIF KLFVYLTALR NGYRPDSVMM DRPTQVGEWE PENYGGRYRG AVTLRSAFAQ       480
     SINTVAVQLA EAVGIPAVIE TAKALGVQSD LPNLPSLALG SAETTLLELT RAYAAVAAGA       540
     ESVEPYAIRQ IASRDQILYT RPATALPPAR DTAARAGMLD LLAAVMREGT GKGARVAVPA       600
     GGKTGTTQDN RDAWFIGFAG DLVVGVWLGN DDNAPMQGVT GGDLPAAIWR DFVTQALAVR       660
     GRAAKAQAAR PERPPPRSEM AAADPDADQR PGRGSLRGTP SVIDTGTLNL DGQTVRLLGV       720
     EGLAGRNARE LGRYLRRRDV ACLPAEGGAY RCSLDGQDLS ELILFNGGGR AGADATPDLL       780
     AAEEQARSNR IGIWRR                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page