(data stored in ACNUC7421 zone)

EMBL: CP001349.PE496

CP001349.PE496       Location/Qualifiers
FT   CDS             complement(573459..574118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55548"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG0"
FT                   /inference="similar to AA sequence:KEGG:RPB_4480"
FT                   /protein_id="ACL55548.1"
FT                   /translation="MLAWRNQAKRGALSSFASSLCQIKQRNNPVGTIRHSVSAVLISAL
FT                   AACGYVPVTSMLKLSAIDFRVTDPRALRAAVELPKAMLPRRVVLRFIGRINNGPDQTEE
FT                   FDLEEINDPTVADVGSVKADRRISAYRLTSADANRLTAFRSSLFRQKAEQGGRGEVNLE
FT                   VRTEGCRAGPFASGPVLATTYIKTSETGTYVPLMRNFDLRTIDPKRDLVETAPQCQ"
     MLAWRNQAKR GALSSFASSL CQIKQRNNPV GTIRHSVSAV LISALAACGY VPVTSMLKLS        60
     AIDFRVTDPR ALRAAVELPK AMLPRRVVLR FIGRINNGPD QTEEFDLEEI NDPTVADVGS       120
     VKADRRISAY RLTSADANRL TAFRSSLFRQ KAEQGGRGEV NLEVRTEGCR AGPFASGPVL       180
     ATTYIKTSET GTYVPLMRNF DLRTIDPKRD LVETAPQCQ                              219
//

If you have problems or comments...

PBIL Back to PBIL home page