(data stored in ACNUC7421 zone)

EMBL: CP001349.PE497

CP001349.PE497       Location/Qualifiers
FT   CDS             574427..575314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0508"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   met:M446_1047 beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55549"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL55549.1"
FT                   /translation="MAQQIPISPEARADGPAGPDGTHAIAPDVAYQRLTLVNVIFVGPP
FT                   GAGDRGWVLIDAGILGSRTAIERAATARFGEGARPSAILLTHGHFDHVGVLEDLAMAWD
FT                   APVWAHPLEKPYLDGSASYPRPDPRVGGGLFSLISPLFPTKPVDVGERLHLLPQDGSVP
FT                   PLPGWRWLHTPGHSVGHVSFWRPVDRLLVAGDAFVTTAQESVYAVALQEPELHGPPRYL
FT                   TLDWEAAHGSVEALARLRPETAITGHGRPLRGPGLREGLDALARDFVIVAVPRDGRYVE
FT                   TPARAEDGSAYRRA"
     MAQQIPISPE ARADGPAGPD GTHAIAPDVA YQRLTLVNVI FVGPPGAGDR GWVLIDAGIL        60
     GSRTAIERAA TARFGEGARP SAILLTHGHF DHVGVLEDLA MAWDAPVWAH PLEKPYLDGS       120
     ASYPRPDPRV GGGLFSLISP LFPTKPVDVG ERLHLLPQDG SVPPLPGWRW LHTPGHSVGH       180
     VSFWRPVDRL LVAGDAFVTT AQESVYAVAL QEPELHGPPR YLTLDWEAAH GSVEALARLR       240
     PETAITGHGR PLRGPGLREG LDALARDFVI VAVPRDGRYV ETPARAEDGS AYRRA            295
//

If you have problems or comments...

PBIL Back to PBIL home page