(data stored in ACNUC7421 zone)

EMBL: CP001349.PE498

CP001349.PE498       Location/Qualifiers
FT   CDS             complement(575716..576576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0509"
FT                   /product="purine nucleotide phosphorylase"
FT                   /note="TIGRFAM: inosine guanosine and xanthosine
FT                   phosphorylase family; purine nucleotide phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1; KEGG:
FT                   met:M446_1622 purine nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55550"
FT                   /db_xref="GOA:B8ICG2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG2"
FT                   /inference="protein motif:TFAM:TIGR01698"
FT                   /protein_id="ACL55550.1"
FT                   /translation="MSRGADPSAAGAAADPRVGQAVARLRAGGFGGPFALAVVAGTGLG
FT                   PLAARIEAPRILPYAEIPHFPVSGVSGHAGQLVAGDLGGRPVLLFQGRAHAYEQGDAAA
FT                   MRVPLGVLAALGAPPLLLTNAAGSLRHEAGPGRLALITDHLNLSGLNPLIGEHSEARFV
FT                   PMVDAYDPGLRKSLHGAAAAADLVLHEGVYAWFLGPSFETPAEIRMAGRLGADLVGMST
FT                   VPEVILARFFGLRVAALSIVTNYAAGFDGGAPHHAETKRVAAAAAEDVGRLLAVWLASG
FT                   GPGEG"
     MSRGADPSAA GAAADPRVGQ AVARLRAGGF GGPFALAVVA GTGLGPLAAR IEAPRILPYA        60
     EIPHFPVSGV SGHAGQLVAG DLGGRPVLLF QGRAHAYEQG DAAAMRVPLG VLAALGAPPL       120
     LLTNAAGSLR HEAGPGRLAL ITDHLNLSGL NPLIGEHSEA RFVPMVDAYD PGLRKSLHGA       180
     AAAADLVLHE GVYAWFLGPS FETPAEIRMA GRLGADLVGM STVPEVILAR FFGLRVAALS       240
     IVTNYAAGFD GGAPHHAETK RVAAAAAEDV GRLLAVWLAS GGPGEG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page