(data stored in ACNUC7421 zone)

EMBL: CP001349.PE499

CP001349.PE499       Location/Qualifiers
FT   CDS             complement(576573..577001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0510"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; KEGG: met:M446_1621 cytidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55551"
FT                   /db_xref="GOA:B8ICG3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG3"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ACL55551.1"
FT                   /translation="MPTVPDRMSPIDALFSAALAVQARAHAPYSGFRVGAAVLDETGAV
FT                   HAGCNVENAAYPVGTCAEAGAIAAMVAGGGRRIAAILVLGDGEALVTPCGACRQRIREF
FT                   AAPDAPVHVAGPEGLRRSFTLDALLPVSFGPDNLGVGA"
     MPTVPDRMSP IDALFSAALA VQARAHAPYS GFRVGAAVLD ETGAVHAGCN VENAAYPVGT        60
     CAEAGAIAAM VAGGGRRIAA ILVLGDGEAL VTPCGACRQR IREFAAPDAP VHVAGPEGLR       120
     RSFTLDALLP VSFGPDNLGV GA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page