(data stored in ACNUC7421 zone)

EMBL: CP001349.PE5

CP001349.PE5         Location/Qualifiers
FT   CDS             6770..8899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0006"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: spe:Spro_1016 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55057"
FT                   /db_xref="GOA:B8ISZ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ5"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACL55057.1"
FT                   /translation="MVKGRVALVVCAAQAAWIGGAVAQGASDPVIALDEISVAGSAPEG
FT                   AVVARGYQPVRSSIVNGTETPILKIPQAVSVVTEQVIRDQQVRTLDEALYNVPGITQAN
FT                   TLGGTQDAVLRRGFGDNRDGSILRDGLRTALPRSFMPTTERVEVLKGPASALYGILDPG
FT                   GLVNIVTKKPRFVPAGTVEAFGTSFNGGGASLDFTGPIEGTELAYRFVAEHRNAEYWRN
FT                   FGTQNQQVLAPSLTWRGDTATVRLFYEFSHYRAPFDRGTIFYPGTHRAVPVPRGRRFDE
FT                   RYNITAGESHVAGFEVNQDLGETWKLDLNYAYSHNFYEDNQARVTAFNAATGRVTRRAD
FT                   ATQDSNFGVHAARLDLTGRVEDPLGFSHELLFGASYDASRVLRTDMIRGPTNAGFSIFA
FT                   PVYGTLPASRAVSAADSDQLERIETAAVYAQDTVAVTERLSLVGGLRYQDFTQQAGKGR
FT                   PFNLNTDVSGGRVVPRVGAVYLLNPETSVYASYSETFRPNSSIASYIGALPPESGEAVE
FT                   VGIKVQTEGITATAAFYDIVKSNVLYTETVNGISVSRTAGRVGSRGFEVDIAGQIAPDW
FT                   SVIATYAYTDAVVLADPLLTGKRLTNVAPQTASLWVTHDFGIVGDGRLRAGAGARYVGY
FT                   RPGDAVNSFKLPDYAVVDAFVAYDTVVAALPTTLQLNIRNLLDTTYYTSSIGTNNLGVE
FT                   VGEPFQVLASARVSF"
     MVKGRVALVV CAAQAAWIGG AVAQGASDPV IALDEISVAG SAPEGAVVAR GYQPVRSSIV        60
     NGTETPILKI PQAVSVVTEQ VIRDQQVRTL DEALYNVPGI TQANTLGGTQ DAVLRRGFGD       120
     NRDGSILRDG LRTALPRSFM PTTERVEVLK GPASALYGIL DPGGLVNIVT KKPRFVPAGT       180
     VEAFGTSFNG GGASLDFTGP IEGTELAYRF VAEHRNAEYW RNFGTQNQQV LAPSLTWRGD       240
     TATVRLFYEF SHYRAPFDRG TIFYPGTHRA VPVPRGRRFD ERYNITAGES HVAGFEVNQD       300
     LGETWKLDLN YAYSHNFYED NQARVTAFNA ATGRVTRRAD ATQDSNFGVH AARLDLTGRV       360
     EDPLGFSHEL LFGASYDASR VLRTDMIRGP TNAGFSIFAP VYGTLPASRA VSAADSDQLE       420
     RIETAAVYAQ DTVAVTERLS LVGGLRYQDF TQQAGKGRPF NLNTDVSGGR VVPRVGAVYL       480
     LNPETSVYAS YSETFRPNSS IASYIGALPP ESGEAVEVGI KVQTEGITAT AAFYDIVKSN       540
     VLYTETVNGI SVSRTAGRVG SRGFEVDIAG QIAPDWSVIA TYAYTDAVVL ADPLLTGKRL       600
     TNVAPQTASL WVTHDFGIVG DGRLRAGAGA RYVGYRPGDA VNSFKLPDYA VVDAFVAYDT       660
     VVAALPTTLQ LNIRNLLDTT YYTSSIGTNN LGVEVGEPFQ VLASARVSF                   709
//

If you have problems or comments...

PBIL Back to PBIL home page